CAZyme Information: MGYG000004758_00107

Basic Information

• Species: Prevotella sp900553155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553155
• CAZyme ID: MGYG000004758_00107
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586		66849.6	9.5548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004758	2740450	MAG	Denmark	Europe

• Gene Location: Start: 44356; End: 46116 Strand: +

Full Sequence      

MKFLDKNLSLLIVLVVAVLMLLPFLGLTDFNTKGEPREAVVAVSMLKDGNWILPVNNGMD
IPYKPPFFHYCIAVLSLLTGGVNEYTSRLPSALSLIAMTIGCFCFYRKRLSTNVAVASAL
LLLTSFEVHRAGASCRVDMMLTVFIVGALLLLYRWWERGSHGVPVLAVLCMSCATLTKGP
VGFVLPCFVMGVFMLLRGEHFWKTFFKFVGFGLLSCILPLMWYVAAWIDGGQQFLDLVYE
ENIGRMTGTMSYESHEHSFPYNFFTLSTGWLPWTLLLIFSLFAKPWKALKWRKTGEKLRI
RIMQIPPVKLFTWLSFLLVLFFYCIPSSKRSVYLLPCYPFMAVLIAQYIEWLWTSNHHRV
LRVYVCVIAAIAIILTAVYGVVHLGLVPDSIFHGKHANENIAILHALRDTKLDFTSFVLM
LMPFVTSVDCLFLTYRKAMRDKKRVMAYCLFMPLVVLMMALDGIYLPTILNTKSLRPMAN
YIQRTFPNEPVYQYVEGSVMHFFGADFYLGDTIDQFEKPVRTRVGDKTVVEKKTPSKGVL
VVSEQQFKALADRHPDYNFAHVATLKGRVSELKDNISFYRFSVKTK

Enzyme Prediction     

No EC number prediction in MGYG000004758_00107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	541	3.9e-82	0.9314814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.70e-31	35	363	35	350	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.44e-10	35	363	33	347	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	7.31e-10	64	222	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam10131	PTPS_related	4.77e-06	63	236	3	177	6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein. This domain is found in various bacterial hypothetical membrane proteins, as well as in tetratricopeptide TPR_2 repeat protein. The exact function of the domain has not, as yet, been established.
COG4745	COG4745	0.003	65	159	67	158	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ74247.1	1.66e-34	26	350	28	340
BBB92576.1	4.42e-25	5	387	5	362
QTL97755.1	3.96e-24	8	346	20	345
BAU11215.1	6.23e-24	5	357	9	355
CBK43751.1	2.28e-23	6	348	23	371

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	8.65e-23	30	350	22	322	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
C5BDQ8	9.28e-15	35	363	32	345	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A4WAM1	9.31e-15	9	348	7	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
O67601	1.70e-14	25	349	23	307	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A8FRR0	3.53e-13	7	347	7	330	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995083	0.004504	0.000116	0.000021	0.000013	0.000300

TMHMM  Annotations     

start	end
7	26
89	106
139	156
176	198
205	227
261	283
304	326
331	353
360	382
413	435
447	469