CAZyme Information: MGYG000004758_00391

Basic Information

• Species: Prevotella sp900553155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553155
• CAZyme ID: MGYG000004758_00391
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		69219.15	6.6207

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004758	2740450	MAG	Denmark	Europe

• Gene Location: Start: 35405; End: 37237 Strand: -

Full Sequence      

MNKFLVKSLLVSTLLSLAGVVAANAQWSAQGNKIKTQWAAQVSPNNISTEYPRPIMQRNR
WQSLDGLWNYSIRRRGAANMGNADGKILVPFAVESSLSGVMKTVGKDQELWYSRTFDIPA
DWQSDHILLHFGAVDWQADVYINDIRIGSHRGGYAPFSLDITPYIDNAKQLQNITIRVFD
PTTDGYQPVGKQKSKPEGIWYTPVTGVWQTVWIEPVAAHHITAINTVSDIDNNRLCITPL
TSTHEGIVEVTISDGKKIIATGKAAAGQPVDLTIDNPHLWSPDDPYLYTANISLFKDGKQ
VDKVESYAAMRKISTRRDANGIMRIQLNNRDIFQMGPLDQGYWPDGLYTAPNDEALRYDI
QLAKRLGFNMIRKHMKTEPARWYTWCDRLGVLVWQDMPCGDSWPEWQMYNFYNGAEVKHS
AESENNFRNEWKEIIDALQPYPCIVTWTPFNERWGQFKTQEIVEWTKAYDPTRLVNPASG
GNHYAVGDMLDIHHYPDPSIMLYDANRPTVLGEYGGLGLPVKGHLWQDDKNWGYAEFKNV
KEVTNRYVEYTDKLQQLVKTGFSAAVYTQTTDVEGEVNGLVTYDRKVLKVDAKRVAKANN
ALCHALDNNN

Enzyme Prediction     

No EC number prediction in MGYG000004758_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	505	2.3e-102	0.5252659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.14e-36	47	595	1	552	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.21e-29	51	302	3	267	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.83e-18	112	484	113	474	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.40e-12	220	311	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	6.15e-11	111	211	68	163	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY53599.1	3.60e-296	20	607	21	608
QIK52952.1	2.74e-294	9	606	6	600
QIK58371.1	5.32e-294	9	607	6	601
QIK54436.1	4.26e-291	25	606	19	600
QIK59849.1	1.22e-290	25	606	19	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.28e-274	23	606	1	586	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3CMG_A	2.70e-23	112	599	53	569	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	2.78e-23	112	599	72	588	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
4JKM_A	9.28e-23	54	492	7	465	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
6ED1_A	1.15e-22	111	474	80	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	1.02e-23	111	447	59	382	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	5.33e-22	111	480	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
A7LXS9	2.48e-21	111	508	105	536	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KPJ7	3.20e-21	111	452	106	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
A5F5U6	2.49e-19	112	527	121	552	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000304	0.998971	0.000183	0.000187	0.000163	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004758_00391.