CAZyme Information: MGYG000004759_01289

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella
• CAZyme ID: MGYG000004759_01289
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214		24016.51	10.6298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004759	2383712	MAG	China	Asia

• Gene Location: Start: 12; End: 656 Strand: +

Full Sequence      

MTSFFTTGGIRGGKKKMDKFYPRSFNMGVRAEAYRALGGFAPMRFGEDIDFSIRIFKEGY
ACRLFPEAWVWHKRRTDLKKFFKQVHNSGIARINLYKKHPESLKLVHMLPAVFTVGVALL
LLLLLVGLVLFAVPSCAAAAPWVTAVAVAPLLCFVLLIFIDASVQNKSPYIGLLAVGASF
VQLIGYGSGFLRAWWQRCVRGKDSFSAFEKTFYK

Enzyme Prediction     

No EC number prediction in MGYG000004759_01289.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	2.59e-16	1	113	134	248	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1216	GT2	1.95e-07	27	109	172	258	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	6.20e-07	27	74	117	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13632	Glyco_trans_2_3	1.04e-04	26	84	76	134	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
COG1215	BcsA	7.58e-04	26	84	218	276	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23991.1	2.71e-105	1	214	133	329
QQA08190.1	4.68e-104	1	214	133	363
BCA48249.1	4.68e-104	1	214	133	363
ABR38238.1	8.92e-104	1	214	133	329
QQY42740.1	8.92e-104	1	214	133	329

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999963	0.000061	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
111	133
138	160
170	192