CAZyme Information: MGYG000004761_00812

Basic Information

• Species: Collinsella sp900552145
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900552145
• CAZyme ID: MGYG000004761_00812
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219	MGYG000004761_36|CGC1	25253.63	5.1212

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004761	2187341	MAG	Spain	Europe

• Gene Location: Start: 14137; End: 14796 Strand: -

Full Sequence      

MPSGIIYRLWLDLITKGELPADVLDSLAEGGVKLPFRAGDQEILKQGVVDWLGCNYYHPT
RVQAPASKIAQYGLPHFADEYVWPDAVMNKSRGWEIYPKGLYDFGMDCAKNYPDLEWFVS
EIGIGIMDEYKNRDAEGTIQDDYRVDFVRQHLEWVAKAIDEGAKCRGYHYWAVIDNWSWA
NAFKNRYGFVEVDLMDGYQRRLKKSAAWLKQVATTHVVD

Enzyme Prediction     

No EC number prediction in MGYG000004761_00812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	215	2.7e-49	0.42424242424242425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.60e-68	7	215	249	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.20e-46	4	216	243	451	Glycosyl hydrolase family 1.
PRK13511	PRK13511	5.10e-36	8	219	244	469	6-phospho-beta-galactosidase; Provisional
PRK09852	PRK09852	2.28e-18	10	219	265	472	cryptic 6-phospho-beta-glucosidase; Provisional
PLN02814	PLN02814	8.88e-09	31	208	301	475	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70290.1	4.76e-158	1	219	248	466
ATP54210.1	6.76e-158	1	219	248	466
BCV18986.1	1.65e-119	1	219	249	467
ACV50514.1	9.42e-116	1	219	247	465
QUC04859.1	5.25e-112	1	219	233	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	1.31e-52	9	214	250	457	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	1.88e-52	9	214	251	458	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAQ_A	8.20e-49	8	212	265	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAV_A	1.61e-48	8	212	265	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
1PBG_A	2.70e-31	27	219	267	468	TheThree-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis [Lactococcus lactis],1PBG_B The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis [Lactococcus lactis],3PBG_A 6-Phospho-Beta-Galactosidase Form-C [Lactococcus lactis],3PBG_B 6-Phospho-Beta-Galactosidase Form-C [Lactococcus lactis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.55e-63	8	213	252	460	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
Q8E4S2	1.52e-31	21	219	261	468	6-phospho-beta-galactosidase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=lacG PE=3 SV=1
C1CEE7	4.03e-31	11	219	247	468	6-phospho-beta-galactosidase OS=Streptococcus pneumoniae (strain JJA) OX=488222 GN=lacG PE=3 SV=1
B8ZQ59	7.73e-31	21	219	261	468	6-phospho-beta-galactosidase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) OX=561276 GN=lacG PE=3 SV=1
Q8DPP6	1.07e-30	11	219	247	468	6-phospho-beta-galactosidase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lacG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004761_00812.