CAZyme Information: MGYG000004763_00157

Basic Information

• Species: CAG-462 sp900291465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900291465
• CAZyme ID: MGYG000004763_00157
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	MGYG000004763_1|CGC4	55799.65	5.9407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004763	3504022	MAG	Denmark	Europe

• Gene Location: Start: 180581; End: 182056 Strand: -

Full Sequence      

MKKNMIGTAMLCAAALSAGLYSCDEEYVDLKYRGTLDLDQLVLKQARDVWNGSESNSVYE
CQFDADKQARNKVYKLNVALYQNRTAAKEAVVDLVVNKDSLSKAIARSAEGGVYEKYAGA
ELLPEEFYTLQNTKLTLNAGAALSDDVNLTLHVPELIDYIQNKVKESRTYVLPLSITHST
AYSINRKVDTWMCFVKVSYVKVEVDPVFLADGEGVPDGHTLEGGYKLLWHDEFNGEGTPN
EAMWRFEEGFQRNEEDQWYSRNNASMKENALVITARRERVKNPNYNPNASGGNAWKQKRE
YAEYTSACVVAKGDYAFKYGRVIVRAKVPVEQGGWPAIWSTGNWYEWPLGGEIDILEFYK
NKIHANLCWGGSSRWSGTWNSKNYPLTHFTGKDPKWADKYHIWRMDWNEKYIRIYLDDEL
LNETNLSTTRNRGDHGAGDGGSINPFSNDMKGFGQCMMLNLAIGGNNGRPIEATFPLEYR
VDYIRVYQKAE

Enzyme Prediction     

No EC number prediction in MGYG000004763_00157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	229	487	1.5e-54	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.34e-67	229	487	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	1.21e-23	306	468	101	279	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	7.07e-19	231	487	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	9.22e-17	224	488	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd02178	GH16_beta_agarase	2.39e-12	231	488	27	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89969.1	2.59e-238	1	489	1	489
ALJ58914.1	5.42e-238	1	489	1	489
ANU56234.1	1.47e-161	1	488	2	506
QQR18928.1	1.47e-161	1	488	2	506
QUU07364.1	9.29e-161	1	488	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CRQ_A	1.02e-29	225	489	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6T2N_AAA	2.09e-29	212	491	39	306	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
6JH5_A	4.09e-27	225	491	4	235	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	2.74e-26	225	491	4	235	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
5WUT_A	1.53e-25	224	488	4	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	4.86e-22	224	489	422	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
P45798	8.98e-22	225	491	40	286	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
Q27082	3.53e-19	225	490	25	255	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q8N0N3	8.98e-19	305	468	132	305	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1
Q9Z3Q2	1.21e-08	253	487	256	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000217	0.023662	0.976105	0.000011	0.000016	0.000013

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004763_00157.