CAZyme Information: MGYG000004763_00723

Basic Information

• Species: CAG-462 sp900291465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900291465
• CAZyme ID: MGYG000004763_00723
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000004763_5|CGC3	36467.22	6.9507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004763	3504022	MAG	Denmark	Europe

• Gene Location: Start: 112260; End: 113231 Strand: +

Full Sequence      

MKQLGMLLLGLLLGVTSYAATDTPDTLVVARDGSGKFRNLWEAIEDCRAFMDYHKVIYVK
KGVYKEKVIIPSWLTNIEILGEDRDETIITYDDHANIRLAGHDTNMGTFRTYTVKVEGSD
ITFRNITIENNAAQKGQAVALHTEGDRLKFVNCRILGNQDTIYTGVAGTRLYFADCYIDG
TTDFIFGPSTAWFERCTLHSKRDSYVTAASTPKEIRYGYVFNHCKLTAEPEVKRVFLGRP
WRPYAYTLFMNCELGGHIVAKGWHNWGKASNEQTARYAEYHNTGAGAATGERAPWSRQLT
DKEAAGITLERVFSIQDTWNPLD

Enzyme Prediction     

No EC number prediction in MGYG000004763_00723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	313	2.1e-99	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.59e-74	27	305	7	288	pectinesterase
pfam01095	Pectinesterase	4.53e-73	28	308	3	290	Pectinesterase.
COG4677	PemB	4.21e-64	56	314	114	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	4.50e-61	26	304	70	352	pectinesterase family protein
PLN02432	PLN02432	4.10e-60	27	305	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA73615.1	1.71e-160	2	323	3	316
QJR75357.1	1.71e-160	2	323	3	316
QJR56781.1	1.71e-160	2	323	3	316
AII67863.1	1.71e-160	2	323	3	316
AII65162.1	1.71e-160	2	323	3	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	7.54e-37	27	308	9	297	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.94e-33	28	295	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.66e-27	57	292	38	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	8.55e-27	57	292	38	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
4PMH_A	1.57e-14	55	241	67	292	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.49e-50	29	304	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.62e-43	26	307	272	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	8.34e-42	26	295	276	552	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	2.52e-41	26	307	259	545	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q43143	1.82e-38	19	295	266	545	Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum OX=4081 GN=PMEU1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000309	0.998968	0.000172	0.000185	0.000170	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004763_00723.