CAZyme Information: MGYG000004764_02166

Basic Information

• Species: UBA2856 sp900555005
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2856; UBA2856 sp900555005
• CAZyme ID: MGYG000004764_02166
• CAZy Family: GH94
• CAZyme Description: Cellobiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		32851.42	7.4321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004764	1953582	MAG	China	Asia

• Gene Location: Start: 53; End: 937 Strand: -

Full Sequence      

MFVRYGKDYAQLCTHRGLPDKAKAAMAEVRRMQQAVLDAGWDGEWFLRAYDAKGQKVGSH
ECEEGKIFIEPQGFCVLAGIGVKEGKAEKALSSVEKHLDTKYGIRILAPSYSHYYLNLGE
ISSYPPGYKENGGIFCHNNPWVSIAETVLGHGTRAFDIYKKTCPAYIEDISEIHCTEPYV
YSQMVAGSDAKYFGQGKNSWLTGTAAWTFVNISQHILGIFPDYDGLRIDPCVPKDFGPYT
VSRRFRGAMYRIHISNPDHVEKGIRKLTVNGKEVSGNLIPITEGVTKYEVDAVM

Enzyme Prediction     

EC	2.4.1.20	2.4.1.49

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17167	Glyco_hydro_36	3.95e-100	1	219	207	424	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG3459	COG3459	2.06e-97	6	294	767	1053	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
COG3408	GDB1	1.87e-08	17	252	438	640	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97229.1	8.37e-152	1	294	522	814
ADL35180.1	1.29e-151	1	294	524	816
QNM04267.1	1.55e-145	1	290	517	806
AEN95786.1	1.60e-141	1	294	520	820
AWY99192.1	4.88e-141	1	294	517	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	3.67e-129	1	294	517	810	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3RRS_A	2.17e-104	2	294	525	822	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3S4C_A	3.29e-103	2	294	525	822	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
2CQS_A	5.34e-102	2	291	545	839	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3ACS_A	5.34e-102	2	291	545	839	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	2.82e-135	1	294	519	812	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	1.12e-60	41	284	547	791	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	1.19e-53	9	274	515	781	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q7S0S2	5.02e-25	9	274	505	769	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
Q8P3J4	9.23e-25	9	255	511	759	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004764_02166.