CAZyme Information: MGYG000004770_00228

Basic Information

• Species: Streptococcus sobrinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sobrinus
• CAZyme ID: MGYG000004770_00228
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000004770_3|CGC2	28918.76	9.9262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004770	2052412	MAG	China	Asia

• Gene Location: Start: 62555; End: 63313 Strand: +

Full Sequence      

MAKKKKSFPSLFKRLFKVKKKNRKSFTLTLILILAIFLFLSYGLYSRMTIIDTQPPKSRQ
DDREVAVLYFINNIGEDARSIAQENDLYASVMIAQAILESNHGTSKLGSEPNYNLFGIKG
NYKGNSASFQTWEDDGKGNTYKINAAFRKYPSYKESLEDYADILSKNLYADARKSNTTNY
QEATQALTGRYATDTSYNAKLNRLIKLYHLTDYDQPINPYKPGQVYNVYRMAYTDIQTLK
SDNNWAKGQLTN

Enzyme Prediction     

No EC number prediction in MGYG000004770_00228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	75	210	1e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	9.80e-64	70	251	323	514	amidase domain-containing protein.
PRK06347	PRK06347	1.76e-61	70	214	153	303	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	1.88e-57	20	215	1	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.81e-28	66	208	7	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.49e-23	75	160	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWN18539.1	4.26e-171	1	252	1	252
AWN21155.1	4.26e-171	1	252	1	252
SQG13947.1	4.26e-171	1	252	1	252
SQG20711.1	1.22e-170	1	252	1	252
AWN61989.1	1.22e-170	1	252	1	252

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.72e-42	70	214	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	7.16e-42	49	219	35	217	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	9.68e-14	70	206	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.31e-13	70	206	6	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.65e-11	70	205	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G222	3.44e-40	49	219	295	477	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	6.37e-39	70	216	183	335	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	1.05e-33	70	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	1.05e-32	70	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	1.49e-32	70	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000025	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	45