CAZyme Information: MGYG000004770_00262

Basic Information

• Species: Streptococcus sobrinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sobrinus
• CAZyme ID: MGYG000004770_00262
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1227	MGYG000004770_4|CGC2	127652.05	3.7765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004770	2052412	MAG	China	Asia

• Gene Location: Start: 22840; End: 26523 Strand: -

Full Sequence      

MPLSKRKIAILLGLLAIGLSWQAATTASADEVQENSSTPSASLAASSESMSSQSVAPASS
GVITTSQNSQPAENANADAQVETQTSDQTNKVQAPASAAANTYDSSNYGAKVPYTTYEAE
DAQLANGASQQASDDVDSTAVEASNQKYVELPNEGSSVTFQVTKPANALNVRYTVPDGTT
GQLDVQINGNSVATLDLNSASSWQYLVGDKEQDSASEGARARFRFDEAHTLLSNVQLQAG
DKITLVKKKGDNVAYGIDFIELEEDQGPKAQPENSISITDKGAVANDGQDDSQALLAAIA
DAQSTGKNVYIPAGQFDLAQKFHVTASNMKISGAGIWHTNLHFTSDQVGGGGFEFDHNDN
GLEISDFFTDSNLTSRYGEAANYKAIAGSLGKDSSIHDFWEQHFEAGMWIGDYDASNMHY
TDGLTVKDSRIRNNLADGINFAQGTKNSTVQNSNIRGNGDDGLASWSSRDGSSNASMDEN
NKYLNNTIELGWRAGGVGIFGGKGHEVANNLIKDNFAGAGIRISTVFPGHNFDNNDTGIN
VHDNLLWRTGTTSDLYNQERGAIDFQTANGDIKNVTIKDNKLLNSFGNSVNAINANFDLP
AQGNGDIHLDNNTIDKDAQLANLVTSAQAPAQSQDSAPAADKQEDVPSQDPAPQADSSQP
STESNQPADQSQADNNQSSTESSQPADQAQADNSQPAESTQPTEPVPEADNNQSTETPSD
QGSAANDNGQAQPNNEAPAQTEEIQPSAENQAAQGQDQSQSADKTSDQTPEVNPAPAADS
PDNGSASAQTEPQAQATENTPAQSETPSVPDQSGQSNTEGQSQDGQAQASNEQDSSAQAD
QPTENQASSQPETPQGQTNAEPAQTVAPKVPEGNMSVESAAPEIPAAEQAHPQAGEQDQA
STDPAAQSETAGPSPAPVAPQPDSAQTPGSVTPSQEQLAATEMPAEEAVLDSAANSDASQ
PSNQETDSADQNSIVKVQAPVADENQDDTPAASQAPSASQPDPTAQPAVDGVSQAPSSDK
EAASDDADNQAANLPEQPTNFLTSNEDQASVAPETPVDQPSVDQADPSQLNSSEQGSANG
NQTTPADQADPSVMVTTPVVGQAPENSSLASAIPDSFSDAAGSDNQAEDNQKSQGNISDP
SDSAQSSNDTSNPSGLSDLPNSPAVPGKGSRPASNQNPSMNTDTSNKPDKKAQALPETGD
SKADSLMIFLGLMIVTFVGSLNKHQED

Enzyme Prediction     

No EC number prediction in MGYG000004770_00262.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	56	624	2.1e-143	0.8911222780569514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	4.28e-35	109	262	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
PRK14949	PRK14949	2.44e-17	645	1081	375	796	DNA polymerase III subunits gamma and tau; Provisional
PHA03247	PHA03247	2.86e-14	625	1178	2570	3089	large tegument protein UL36; Provisional
PRK07764	PRK07764	2.94e-14	621	1038	385	797	DNA polymerase III subunits gamma and tau; Validated
PHA03247	PHA03247	2.56e-13	627	1062	2632	3092	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWN19722.1	0.0	1	1227	1	1227
AWN21666.1	0.0	1	1227	1	1227
SQG14508.1	0.0	1	1227	1	1227
AWN62446.1	0.0	1	1227	1	1204
AWN64321.1	0.0	1	1227	1	1204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	7.95e-123	109	585	13	497	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	1.79e-48	109	579	54	496	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	4.51e-37	106	579	11	481	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	4.66e-36	106	579	11	481	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	4.66e-36	106	579	11	481	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000468	0.998695	0.000286	0.000194	0.000167	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004770_00262.