CAZyme Information: MGYG000004770_00897

Basic Information

• Species: Streptococcus sobrinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sobrinus
• CAZyme ID: MGYG000004770_00897
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000004770_15|CGC1	38699.47	6.3529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004770	2052412	MAG	China	Asia

• Gene Location: Start: 45931; End: 46953 Strand: +

Full Sequence      

MRNKYLIDFIRDDTNTAASKAERDISSFLKTIGFLGINYDMSLPRAIKILGEDYILAKKI
KCIEADDICLMQYSMFGRPSLKKLMKKLAFNRYKILLIHDIETLREQMGTNGIAEELALL
QEAQCLIVHNDKMADWLREQGLKVPMISLEIFDYAQPVDLKEVRVQNDWKTVVFAGNLDK
SSFLRQLKTQTPFYLYGLKSHDQAYQENLTYCGSKTSTEIPSVVSQYGFGLVWDGPGIDS
CQGAVGNYMRYNNPHKTSLYLSSNLPVIIWKEAALAGFVEEHGLGLTLDSLEELDDRLAR
LSQADYDQMKTNCQAMGQRLRNGYYTIKATQEAVEVVGKY

Enzyme Prediction     

No EC number prediction in MGYG000004770_00897.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	11	334	8.2e-105	0.984472049689441

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.65e-99	3	337	2	333	sugar transferase.
cd03794	GT4_WbuB-like	0.005	79	321	109	374	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQG19948.1	7.65e-250	1	340	1	340
AWN63468.1	7.65e-250	1	340	1	340
AWN61596.1	7.65e-250	1	340	1	340
AWN18940.1	1.80e-248	1	340	1	340
SQG13623.1	1.42e-245	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	7.22e-16	82	334	84	326	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	7.67e-16	82	334	92	334	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	3.75e-38	7	335	7	325	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	2.24e-24	12	338	14	334	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
F8KEJ1	2.10e-22	90	334	96	334	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
Q9AEU1	3.37e-21	21	334	20	329	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	8.71e-21	90	334	91	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004770_00897.