CAZyme Information: MGYG000004772_00793

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004772_00793
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		30443.59	4.5403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004772	1545078	MAG	Spain	Europe

• Gene Location: Start: 79; End: 912 Strand: -

Full Sequence      

MTSTLPAPIDKLAIVVVTYKRQELLANLFDSMTELTAAPWRIVIVDNENSRETEAMCSAF
NERLANLWGIDTEQPDAQGGTDRVIYAPQLENGGGAGGFSAGTKRAYDLGAQWFWVMDAD
VLVIPEGIERLAKWTDRYDVIQGSRLDFDGGAFFWQYQLILSLGIPNPIAKWDLGPEGYR
TMNQLCFEGGLFSRRVVDQIGLPDARFFIYGDDACYGNVASQHIPAAVVTAVVLKRARAV
SNRDIAGFPVVWQAIADKTSGSVIPYLCSAIHAPNFA

Enzyme Prediction     

No EC number prediction in MGYG000004772_00793.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	14	170	2.5e-18	0.8058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	1.11e-34	15	247	2	183	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	9.88e-11	14	197	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	1.11e-10	10	217	3	199	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13641	Glyco_tranf_2_3	1.08e-08	10	223	2	197	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd00761	Glyco_tranf_GTA_type	4.13e-06	14	173	1	137	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33439.1	2.00e-171	1	247	1	247
ATP53743.1	8.43e-171	1	247	1	247
AZH69429.1	2.33e-170	1	247	1	247
BAF39739.1	2.98e-106	8	247	10	247
AZH71606.1	3.43e-105	9	247	11	247

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	2.18e-12	15	213	10	194	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	3.23e-09	15	213	8	191	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	3.23e-09	15	213	8	191	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004772_00793.