CAZyme Information: MGYG000004772_00912

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004772_00912
• CAZy Family: CE9
• CAZyme Description: N-acetylglucosamine-6-phosphate deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		19438.59	4.2829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004772	1545078	MAG	Spain	Europe

• Gene Location: Start: 2638; End: 3183 Strand: +

Full Sequence      

MSTYAIKADKFFLPAGPQLGGYLMVEDGVFGAWQADEPSCEIRDYTGSWIAPGMVDTHIH
GFYNHSTTDNDPEGIDISSTELARRGTTSWLPTTFTEGVEQIKDACAAIAPADEGRGPDF
CGARIQGIYLEGPFFTMKHVGAQNPAYLIDPSEEVSDRWQEAAGGRIVKSAMAAARDGAA
A

Enzyme Prediction     

No EC number prediction in MGYG000004772_00912.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE9	18	180	3.9e-39	0.4316353887399464

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1820	NagA	1.92e-47	3	169	1	165	N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism].
cd00854	NagA	3.70e-46	4	169	1	164	N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling.
COG0402	SsnA	2.84e-08	1	60	1	65	Cytosine/adenosine deaminase or related metal-dependent hydrolase [Nucleotide transport and metabolism, General function prediction only].
PRK11170	nagA	4.69e-07	23	157	21	157	N-acetylglucosamine-6-phosphate deacetylase; Provisional
PRK09228	PRK09228	2.82e-06	21	60	32	78	guanine deaminase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33930.1	6.11e-128	1	181	1	181
AZH70255.1	7.07e-127	1	181	1	181
ATP54175.1	1.16e-125	1	181	1	181
ATP54184.1	2.40e-120	1	181	1	181
BBH50707.1	9.40e-86	1	178	1	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VHL_A	4.25e-22	21	167	22	172	TheThree-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis],2VHL_B The Three-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis]
7NUT_A	3.81e-08	20	148	35	160	ChainA, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUT_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_A Chain A, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34450	2.33e-21	21	167	22	172	N-acetylglucosamine-6-phosphate deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagA PE=1 SV=1
Q8XAC3	4.12e-17	3	145	2	139	N-acetylgalactosamine-6-phosphate deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=agaA PE=1 SV=2
Q84F86	7.43e-16	46	173	50	174	N-acetylglucosamine-6-phosphate deacetylase OS=Lysinibacillus sphaericus OX=1421 GN=nagA PE=2 SV=1
P96166	1.14e-13	50	179	57	183	N-acetylglucosamine-6-phosphate deacetylase OS=Vibrio furnissii OX=29494 GN=manD PE=3 SV=1
Q8JZV7	1.83e-08	20	148	35	160	N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus OX=10090 GN=Amdhd2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004772_00912.