CAZyme Information: MGYG000004772_01175

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004772_01175
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000004772_274|CGC1	34426.68	4.6179

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004772	1545078	MAG	Spain	Europe

• Gene Location: Start: 64; End: 984 Strand: +

Full Sequence      

MKYWLTFNEINMILHLPFMGAGLVFEEGENKEAVEYLAAHNELVASAWATKIAHEIDPED
KIGCMLAAGTYYPYGCRPGDVRQAQLDNQDNYFFVDVQSRGYYPAYAGKKLERLGIDVGM
TDEDREILAANTVDFISFSYYSTRCSAGADNPEVEKTQGNAFAGAKNPYLQESQWGWAID
PLGFRITLNDLYDRYQKPLFVVENGLGAKDVVEEDGSIHDPYRIAYLRSHIKAMGEAIAD
GVDLIAYTCWGPIDLVSAGTGEMRKRYGFIYVDKYDDGTGTYERRRKDSFFAYQKIIKAK
GTEGLA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	301	3.7e-74	0.627039627039627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09593	arb	5.67e-164	1	303	174	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.49e-161	1	303	172	472	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	2.02e-128	1	303	168	475	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	5.79e-121	2	303	161	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	1.99e-104	1	301	170	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68819.1	2.78e-195	2	303	172	474
ATP54514.1	2.32e-182	2	303	172	474
QWT17213.1	5.06e-162	2	303	172	473
QIA32972.1	1.43e-154	2	303	172	474
AEB07701.1	1.72e-150	2	303	172	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.32e-128	2	301	168	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	3.15e-101	2	303	173	478	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.73e-97	2	303	172	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.05e-96	2	303	172	479	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	4.60e-94	2	301	180	482	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	5.84e-132	2	303	173	472	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	2.09e-123	2	301	168	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	5.15e-110	2	301	166	460	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	6.47e-108	2	301	165	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	1.10e-107	4	301	167	459	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.881743	0.114996	0.002785	0.000166	0.000114	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004772_01175.