CAZyme Information: MGYG000004774_01559

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370
• CAZyme ID: MGYG000004774_01559
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		64029.92	5.7057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004774	2727188	MAG	China	Asia

• Gene Location: Start: 2467; End: 4188 Strand: +

Full Sequence      

MVDLYGNPFYLDEEGVRWVRDTIQGMSRHEKICQLFADPLMGMNREGLIGFLEKYPIGGI
PFRAALFGNEEAQEIMADLQERAKIPYLYAGNCESGPNGALKGGTLVASGAQVRALRDPK
YAYEVGSITGKEISAVGYNWSFGPVGDILMNWRNSLINTRAYGEDADFVSQCVEEYNRGC
MEYGVAPCLKHFPGDGWEERDQHLAIGNNGLTCEEWDNTYGKIYRNAIEHGVLSIMVAHF
TMPAYQRKLNPDLKDKDMQPACTSKELVDGLLRRQLGFNGLAVTDQTKMMGYYGMSRLKA
VPWSIACGCDMILGINDMEEDYQAMKQGIESGIITPQRLQDALERILACKAAIGLHKKKQ
NHQFYAGKEALQVIGCPEHQEIAREAAAKAVTLVKNTKGQIPLSPERYKKIGVFVFSGNV
GNQRSIYGQGVQSGGSGATTGYILEALKKYGYEPELMESSMNKGPIKALKNKYDAIMIFA
DISGFAQTNSVRLMWPDPMSNCYPWYIHDVPTVFTSFNYTNHLIDVSRVPAFINAYNNRP
DTIEETIKRIAGIEPFEGAYDENVWCGTWDTRF

Enzyme Prediction     

No EC number prediction in MGYG000004774_01559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	80	313	4.1e-49	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.59e-61	26	423	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.23e-50	30	347	4	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.33e-19	117	360	90	310	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.29e-12	19	403	38	407	beta-glucosidase BglX.
PLN03080	PLN03080	1.51e-05	163	413	174	425	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCX33673.1	3.84e-177	1	572	3	565
ADQ14511.1	3.31e-176	1	572	1	567
QFK73268.1	6.11e-175	2	572	4	571
QLC59446.1	7.96e-174	1	572	3	575
QEK07326.1	7.96e-174	1	572	3	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.40e-108	8	572	10	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	1.28e-40	23	411	39	455	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.64e-40	23	411	13	429	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	6.26e-40	23	411	43	459	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	2.27e-33	57	396	43	378	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	2.19e-126	1	572	1	563	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	7.00e-40	23	411	39	455	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q7NWB7	5.51e-21	120	378	101	345	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q5FA94	3.73e-19	122	316	107	290	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1
B4RQ67	5.01e-19	121	316	106	290	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004774_01559.