CAZyme Information: MGYG000004774_02004

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370
• CAZyme ID: MGYG000004774_02004
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000004774_52|CGC1	43934.08	4.6683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004774	2727188	MAG	China	Asia

• Gene Location: Start: 2356; End: 3486 Strand: +

Full Sequence      

MEILDRYIDQLLERSTPQAPIWNIEKIREGAKPSWNYMDGCMINAILELYLIRKNPKYLE
FADSFIDYFVKEDGQILSYSPEEYNLDNVNAGKTLFDLYDLTGKEKYRKAMDTVYSQLKK
QPRTSTGNFWHKKIYPNQIWLDGLYMAQPFYMQYEASYNDCKGCRDSYEQFLHVYDLMRD
CRNGLYYHAYDDSRKAFWCDKVTGLSDNFWLRALGWYAMALIDTMDVMPASMEQEQAELG
RIYKELIDAMLPYQDEETGMWYQVVNRGGIAPNYLETSGSAIFAFAIMKSVRLGFLDDSY
YAYGKKAFDGICRTQLSERDGELQLDSICLVAGLGNKEMREGTFDYYMREPIVKNEAKGV
APLILAYIEVMMREGR

Enzyme Prediction     

No EC number prediction in MGYG000004774_02004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	371	1.8e-110	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.09e-84	32	369	31	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.57e-80	35	373	27	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX91776.1	6.89e-230	1	373	1	373
ANU47524.1	1.62e-228	1	373	1	373
QQR03578.1	1.62e-228	1	373	1	373
QRP36827.1	5.40e-227	1	373	1	373
ASN98361.1	5.40e-227	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.31e-99	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.22e-66	35	370	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.20e-65	35	370	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	5.59e-07	167	313	195	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	7.26e-06	167	373	196	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.86e-65	35	370	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.28e-41	146	372	1	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.28e-41	146	372	1	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004774_02004.