CAZyme Information: MGYG000004775_00452

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32
• CAZyme ID: MGYG000004775_00452
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		95019.88	4.8953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004775	2980538	MAG	China	Asia

• Gene Location: Start: 5257; End: 7743 Strand: -

Full Sequence      

MQYVGDRTNEISFPLGGIGSGSIGLAGNGRLIDWEIFNRPNKESYNGYSHIAVKAERQGK
LLDARVLNGDVNKGYSGPSGMGLENTSMAGFPHFQKCIFKGEFPLAEIQFEDVHFPGKVT
LRAFNPFIPLNDADSSIPAAFIEIEFQNDDREELQYSAAFTVQNPASKGRNQFVEKELRF
LTTQYAEDHPQFGELCLATDADGEISYQEYWYRGGWSDSLETYWRNFTEQSTLKVRSYEE
PGDRDHGTLCVRKTVPAGHSVRIRFILTWHYPNNYNYWAPEYQHIMWKNYYAVLFSNARE
SAAYGLANWDRLYGETKRFKDELYASSLPEAIIEAISATMSVIKTATVLRLEDGSIYGWE
GLRKDAGSCEGTCTHVWNYAYVLPYLFPKLERSIRSLDYHYNQDENGRMQFRMLLPLGRP
RGTFRACVDGQMGGIVKVYREWKISGDDHWLKEIWPAVKKSLEYAWSEDNEDRWDRDRDG
VLEGRQHHTLDMELFGPSSWLEGFYLAALKAAEEMARYLGEEDSADEYKELFEKGRAWSE
EHLFNGRYYIQQIDLKDASVLEPYEGAEAYWNQEVGEIKYQIGEGCEIDQLCAQWHANIV
GLGSIFDKDHVRTALSSLYQQNVKHSMRDFYNPWRLFCINDEGGAVICEYPEGTEKPAIP
IPYCQETMHGFEYQLAALMISEGMVEEGVEIVTMIRDRYDGKKRNPWNEIECGNNYARSM
ASYSMIPIFSGFIFDMPKGVIGFNPILKKEAFRCIWSLDSAWGNVQIEGEQVLIRVIKGQ
VTLRELQLPFITREIRAVQVDGQSVNVKCQGGRILFASPTTVQERIQV

Enzyme Prediction     

No EC number prediction in MGYG000004775_00452.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	366	725	2.7e-68	0.9669421487603306

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04685	DUF608	4.04e-53	369	725	6	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam12215	Glyco_hydr_116N	3.39e-47	26	312	15	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
COG4354	COG4354	2.26e-37	1	733	3	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam17389	Bac_rhamnosid6H	6.76e-06	439	552	108	217	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANE45793.1	0.0	3	822	5	857
AZN43107.1	0.0	1	816	3	847
QGQ98288.1	0.0	3	824	5	862
QGQ98507.1	0.0	1	824	4	858
QHT59778.1	0.0	1	816	3	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DKW_A	1.34e-22	14	707	59	757	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKW_B Chain B, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKX_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKY_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
7W2V_A	1.43e-22	14	720	102	817	ChainA, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11]
7DKS_A	1.77e-22	14	707	59	757	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	2.29e-22	14	707	55	753	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	2.33e-22	14	707	58	756	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5M868	4.77e-19	14	688	144	832	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q9HCG7	3.31e-18	14	730	153	885	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q69ZF3	1.71e-17	14	688	144	832	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q7KT91	1.48e-13	450	690	687	893	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004775_00452.