CAZyme Information: MGYG000004780_00078

Basic Information

• Species: Neisseria sp000186165
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria sp000186165
• CAZyme ID: MGYG000004780_00078
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000004780_1|CGC2	79527.9	8.8037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004780	2198368	MAG	China	Asia

• Gene Location: Start: 84073; End: 86190 Strand: -

Full Sequence      

MFLFSDGLQSINNDNRRKRIVKNAYIPSRGIRKIPHLSTLLPEFHICKDGKGAGAVVGWG
LRPTTHKARAFAAEHQLPFIALEDGFLRSLGLGVAGYPPYSIVYDDLGIYYDTTRPSRLE
QLILAADTMPSETLAQAQQAMDFILRHHLSKYNHAPELSDDHPLRSPSKPETVLIIDQTF
GDMAIQYGGADASTFELMFQTALNENPQADIWVKTHPDVLCGKKQGYLTRLAQQHRVHLL
AEDINPISLLQNVDKVYCVTSQMGFEALLCGKPLTTFGLPWYAGWGVSDDRHPEINRLVQ
TQRRATRNLLQLFAAAYLQYSRYLNPNTGEAGSLFDVIDYLATVKRKNDKLRGELYCVGM
SLWKRAVAKPFFNVPSCRLKFISSTQKLAGVKLSDDARILAWGNGKEAIVRFAEQHHIPL
LRMEDGFIRSVGLGSNLVPPLSLVTDDMGIYFNAETPSRLEHILQNQDFNNQDFQTALKL
QKMLTENRISKYNVGSSDFTAPSTDKTVILVPGQVEDDASIRYGSPQIYRNLDLLRTVRE
RNPDAYIIYKPHPDVVSGNRIGHISPEDTARYADQTAEQADILTCLQYADEVHTMTSLTG
FEALLRGKKVSCYGLPFYAGWGLTQDLLPIPPRRSRRLELWQLIAGTLIHYPDYIHPETH
QAINAETAAQILIQQKNMQKNNNGLHRGYFAKKLGKIKQLYRSFK

Enzyme Prediction     

No EC number prediction in MGYG000004780_00078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	302	699	3.9e-155	0.7406015037593985
GT107	20	347	6.5e-106	0.5864661654135338

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	21	705	1	671	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16440	beta_Kdo_transferase_KpsC_1	8.64e-164	56	326	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16439	beta_Kdo_transferase_KpsC_2	1.13e-160	397	654	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	8.60e-107	399	654	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	1.89e-100	56	323	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARD14822.1	0.0	1	705	1	704
AEQ62020.1	0.0	1	705	1	704
CCP19724.1	0.0	1	705	1	704
AEQ62079.1	0.0	1	705	1	704
CCP19935.1	0.0	1	705	1	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	4.88e-100	26	376	5	353	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	2.48e-86	31	341	19	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	2.00e-82	354	681	3	324	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57037	0.0	1	705	1	704	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	0.0	1	705	1	704	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P42217	6.33e-205	26	674	4	643	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P31858	4.26e-58	359	677	80	404	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004780_00078.