CAZyme Information: MGYG000004780_01498

Basic Information

• Species: Neisseria sp000186165
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria sp000186165
• CAZyme ID: MGYG000004780_01498
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000004780_19|CGC1	86711.3	4.3625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004780	2198368	MAG	China	Asia

• Gene Location: Start: 14547; End: 16982 Strand: -

Full Sequence      

MVNIKKAVPDASQYGTKLGYTTYEAEQGELKNGIVKNAPSSEAEHATVREASGQAYVDLP
TNASVSFIAQADANAVTVRYTVPDGESGKVEVKVNNTVIGTLDLSSKSNWQYLDNYKYHP
DGDIKVHDTPAADRLARFQFDEVSQLFKEANIKVGDKVTITNIDSTPVGIDLVDLEKAPD
AIKQPENSVSITDFGAVANDGSDDYQAFMAAIESAKASKKSVYIPEGQFDFSEQLHIYAP
EGVKISGAGQWHTKLHFTSTKIGGGGIVFEHGTNKIDFGNVSMDSDLTSRYNEGANYKGI
SGTLGNGSLIHDIKIEHFEVGAWIGDYAPASDMHYTDGLTISNATIRNNLADGVNFAQGT
SNSTVINSNIRGNGDDGLATWSSIHENTNAHVAENNRFLNNTVELGWRAAGIGIFGGKGH
EVANNLIKDNANWGGVRLNTVFKKSHNFDFNDTGISVHDNLLVSNGTNADTYGRVKGSID
LEEGRDYATPEKDILGELKNIKIENNTIVNNLSDQEITKTRNPKEGNIPESVNETTLTIE
NNHSLSVAENNSAKNVAEVDDHSLTQAAFHLGEDNIITITDSSHALVSGGDGNDRIRGSL
GNDTINGDSGDDVIFGYDGDDRLNGGMGNDSVHGGNGNDTLWGESGDDRLSGGDGDDVLF
GGQGTDYLVGGKGADTYVFSLGEGKDTIVDNVGEHNALQFGQNISVNDLHIDVATDVRGN
TDWKITIKGSEGDSITINDQFVSGKTDAVIDTFRFDEGTLSLQELMGRLSGNSNISNLSA
VNTHTERMSYSSVNTADVHDDAASSANAGII

Enzyme Prediction     

No EC number prediction in MGYG000004780_01498.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	12	568	1.5e-120	0.8358458961474037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033203	entero_EhxA	2.71e-21	589	709	725	862	enterohemolysin EhxA. Members of this family are the RTX toxin called enterohemolysin or EhxA, because it is found in enterohemorrhagic Escherichia coli (EHEC) strains such as O157:H7.
NF033943	RTX_toxin	1.44e-19	578	741	660	802	RTX family hemolysin. RTX family toxin are secreted from the bacteria and inserted into the membranes of infected cells, causing host cell rupture.
cd14490	CBM6-CBM35-CBM36_like_1	1.61e-18	15	175	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
COG2931	COG2931	2.47e-13	572	723	291	458	Ca2+-binding protein, RTX toxin-related [Secondary metabolites biosynthesis, transport and catabolism].
NF033203	entero_EhxA	1.61e-10	588	701	688	798	enterohemolysin EhxA. Members of this family are the RTX toxin called enterohemolysin or EhxA, because it is found in enterohemorrhagic Escherichia coli (EHEC) strains such as O157:H7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKI22002.1	0.0	1	811	1	811
QMT37009.1	2.35e-250	10	802	8	843
ARC49812.1	1.70e-167	14	519	139	625
CCB95088.1	2.08e-167	14	519	140	626
CCB93603.1	2.45e-167	14	519	140	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	2.69e-102	12	510	10	496	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	1.71e-35	15	482	54	477	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999469	0.000540	0.000009	0.000002	0.000001	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004780_01498.