CAZyme Information: MGYG000004780_01924

Basic Information

• Species: Neisseria sp000186165
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria sp000186165
• CAZyme ID: MGYG000004780_01924
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		36242.97	8.2325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004780	2198368	MAG	China	Asia

• Gene Location: Start: 7454; End: 8422 Strand: -

Full Sequence      

MKILLVRLSSMGDLIHTLPAVEDLARQCPEVELHWLCEAGFADIARLHPFVKKVHVMKWR
QWRKHLFQAETWREIGRLKTDLQAESFDFVLDSQGLIKSACFAKMAKSPIYGLDKHSARE
SLVALAYSKTFAVPKGKNAVWRNRELFAQVFGYTMPETQVFGLSVPESGRLKNVQSPYYV
ALHATSRDSKLWPVENWRALLKKLNEEQQCNVYLPWGNETEKMRAEQIASDLPFAFVCDK
MNLLQAAFLLKNAEGIIGVDTGLLHLANALEKPVVGIYTDTDPAKTGVQVSAYAKNLGGI
AQIPNVDEVYQTLMDCVAAYGK

Enzyme Prediction     

No EC number prediction in MGYG000004780_01924.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	288	1.5e-35	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02193	heptsyl_trn_I	9.45e-161	2	317	1	319	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10964	PRK10964	7.49e-90	1	313	1	316	lipopolysaccharide heptosyltransferase RfaC.
COG0859	RfaF	7.28e-80	1	286	2	285	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.33e-70	75	300	1	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	5.83e-46	2	287	1	231	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW90798.1	5.47e-234	1	322	1	322
QXW93924.1	5.47e-234	1	322	1	322
QCL71648.1	2.23e-233	1	322	1	322
QCL69612.1	1.50e-231	1	322	1	322
QKI22881.1	2.05e-229	1	322	1	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	5.71e-63	1	296	1	293	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	5.71e-63	1	296	1	293	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	7.15e-63	1	296	1	293	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	6.46e-63	1	296	1	293	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	3.34e-59	1	296	1	293	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004780_01924.