CAZyme Information: MGYG000004783_00260

Basic Information

• Species: UMGS882 sp003343885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882; UMGS882 sp003343885
• CAZyme ID: MGYG000004783_00260
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792	MGYG000004783_4|CGC1	89122.82	5.1322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004783	2403240	MAG	China	Asia

• Gene Location: Start: 8184; End: 10562 Strand: +

Full Sequence      

MISNKFIKATKDYCTYEKNVSAPYIRKTFTLEEKPAKAEITLTSTGFYRIWVNGKEITGS
RLAPCITNPDDIIFYDKYDITDLIEKGNNCLAFILGNSMGNSVGGFIWDFDKALFRSAPK
LAVHFEATLSSENKYEFEADESFRCAPSPIFFDDLRSGEFYDACAEIENWNKADFDDSSW
NSATITDPARGKALLNDTDKIVVTKELKPVKIYEGYTLPIEVPEAVRPDSRKLSETAFYK
PEANEKGYVFEFSENTACVPRLRIKGRKGQKLIIQCAEYCSEDGGISYENISRFYPEGFC
QRDIYICKGDGVEEYVPSFTYHGARYFLLIGADKDQISDETLTMLVQNSDLHERGNFSCS
DPIANALQRNTRISDLANFVYFPTDCPHREKNGWTGDAAMSAEHMMQNISVEKSWKQWLK
MICATQREDGAIPGIIPTSGWGYAWGNGPVWDQVIVELPYMAYIYRGDISLFEQCADAVM
KYLNYISKRRSPDGSVCVGLGDWCHAMRGSGGSNHTCPTEVSDTITCVNICRKAKFLFEK
CGLKAQAVFAGALEKEFLAAVRERMIDFDTMTVKGSCQAAQAMGLYYNIFETGEKAAAYA
RLLEFVHEADDHFNCGMIGVRVMFRVLASFGDADLAYRMITRTDAPSYGIWVKEFGLASM
AETFNDTVNGHRTSLNHHFMADISGFFISHVAGLQINPYKDNPAFVRVAPSFIDTLDNAS
AYYDTVSGTVRVKWERNGEDIILTTEKQGGVSGEVVLPKGYIFTEKTQAADSWMNDRRIY
ALENAVYTVRRK

Enzyme Prediction     

No EC number prediction in MGYG000004783_00260.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	244	757	5.9e-107	0.9900793650793651
CBM67	18	189	1.2e-28	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.47e-62	355	691	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.74e-33	34	192	2	159	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.00e-15	242	346	2	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.00e-07	696	758	2	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	4.37e-133	17	738	138	821
AHF16194.1	5.38e-126	17	758	167	862
QGA23306.1	5.39e-121	21	757	160	862
APO32478.1	1.92e-120	247	596	22	364
QUT48046.1	2.17e-117	22	755	140	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.12e-82	22	759	176	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.22e-57	21	758	301	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.37e-48	26	740	135	822	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.81e-67	24	758	176	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	1.18e-64	21	757	183	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.60e-64	24	769	172	890	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	2.18e-56	21	758	301	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004783_00260.