CAZyme Information: MGYG000004783_00680

Basic Information

• Species: UMGS882 sp003343885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882; UMGS882 sp003343885
• CAZyme ID: MGYG000004783_00680
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37098.83	4.8365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004783	2403240	MAG	China	Asia

• Gene Location: Start: 5522; End: 6502 Strand: +

Full Sequence      

MTKKDNTAIKGEQRLSLEKLHKWETLKYGMFIHFGMSTFDECELPDGNSPSTKYAPTDLD
VAQWIRVAKEAGMRYAVLTTKHVAGHCLWPSEYTDYSVKTSSNTTDVVGAFVEECRKQGL
MPGLYYCSWDNHTRLGSVTPSDIEDGYDGFTTREYQEYMSNQIRELLTNYGDIGEVWIDI
PPVLGRAYRTELYNEIASLQPEALILMNNGIGDGENFSVRNSWPSDLIPIERYLPNSNGG
YRKWRTIEGKQYYMPGEVCDPIGKEWFYTDDDAPRSDAELLGMYLVSTSRGTNFLLDVGP
DKTGKIPKKYVDALMRLKNNIDKLGM

Enzyme Prediction     

No EC number prediction in MGYG000004783_00680.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	16	319	5.7e-73	0.8583815028901735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	1.43e-46	19	314	17	321	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.44e-36	18	317	17	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	2.08e-29	23	325	18	316	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY36601.1	8.30e-145	11	325	5	331
AUP80668.1	1.84e-113	13	324	39	367
QBG46630.1	3.91e-113	10	326	19	340
CAZ94414.1	1.32e-108	4	322	34	367
AIE84535.1	2.24e-106	15	316	1	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EYP_A	6.22e-41	22	323	16	321	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
5K9H_A	1.40e-38	22	306	45	337	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6GN6_A	5.80e-34	27	314	38	337	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
4ZRX_A	1.68e-33	21	314	37	345	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
6ORG_A	1.04e-30	31	314	26	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	8.26e-44	22	321	44	343	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	7.67e-34	22	314	46	334	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	5.01e-18	60	319	106	351	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q60HF8	3.45e-10	15	317	46	360	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
Q2KIM0	1.97e-09	15	315	47	359	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004783_00680.