CAZyme Information: MGYG000004784_00954

Basic Information

• Species: Dysosmobacter sp900550685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900550685
• CAZyme ID: MGYG000004784_00954
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		59918.97	4.4779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004784	1863924	MAG	China	Asia

• Gene Location: Start: 18965; End: 20602 Strand: -

Full Sequence      

MKRHFGKWLAAAVLAVGCTTITAGAFTDTTGHWAESAINKWSQEYGIIQGYDDGTFRPDN
SITRGAFAGILDRFLHFQETSPASTFSDTAGTYWEDAILKLHASGVYLGNQGKALSASTI
TRQQAVAMIGRAFNIPLETTSVSYSDGSSIAEYALPYVAEFEAHGYLTDCTDSRFRPTDA
ITRAEIVNILGNMIHTLVKENTTWTTDVPGTLLISAQEGAALKGVTVSGDLILAPGVKGN
VTLTDTTVTGSICNYGTGQVVMEEAKPDPTPKPEPEEPAKPGIQPSEVYTPGATLDRTFT
YNGKTIPIYRDRTLNVFSNSDFIWSEEHPDRLEYLGDEFRTRYGIDVSSYQGTIDWDAVA
ADDIDYAMVRVGYRGYGNGTLNADKNYVQNIKGAMNAGLKTGVYFFAQAITVEEAIEEAD
YVISLLDGLDIDGPVAYDWEMHDATYRVYGTSPEMATACAVAFCERIKEAGYTPMVYAGT
YVSYMKYDQGALSEYLSWYPEYKSSKSEKLCPSLIYHMDYWQFSSSCTVAGISGRVDMNI
QFIRR

Enzyme Prediction     

No EC number prediction in MGYG000004784_00954.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	345	532	5.8e-41	0.9943502824858758
SLH	26	65	4.5e-16	0.9285714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.23e-71	344	542	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.62e-30	343	540	1	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	9.07e-22	344	539	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	6.03e-20	344	539	65	251	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
pfam01183	Glyco_hydro_25	1.01e-19	345	532	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCI60549.1	2.81e-256	2	545	4	546
BCK85948.1	5.83e-252	1	545	1	550
QUO37824.1	2.42e-236	2	542	3	556
BAK99312.1	1.00e-197	4	543	3	542
QNL45744.1	2.00e-177	12	545	12	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	4.96e-10	308	542	247	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	4.96e-10	308	542	247	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	1.28e-09	344	539	7	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	1.15e-11	26	195	1682	1856	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P19424	2.41e-09	44	234	59	250	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
C6CRV0	2.71e-09	33	190	1291	1455	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P25310	1.64e-08	344	539	84	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
Q06852	7.83e-08	48	195	2104	2265	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000822	0.630472	0.367830	0.000378	0.000254	0.000222

TMHMM  Annotations     

start	end
5	27