CAZyme Information: MGYG000004788_00230

Basic Information

• Species: Companilactobacillus farciminis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Companilactobacillus; Companilactobacillus farciminis
• CAZyme ID: MGYG000004788_00230
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000004788_3|CGC1	43427.37	10.0718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004788	2403188	MAG	China	Asia

• Gene Location: Start: 9709; End: 10872 Strand: -

Full Sequence      

MMFKRHKYQWLIGGLIILVSFAIGFAIYSTSVKESTTGISSETVKSQYKIWEKAYLRGND
TQKFVKTNNGTKAQTLSEAQGYGMLITVMAAQQGFGNQKTFNQLTNYYLSHRISADNPLM
AWRQTQTANKMVSTKAEKTSATDGDLDIAYSLILADKKWGSKGKIDYQKLAVDLIQGISK
YEINPETSLPKVGDWATGKNQNVVRTSDLISAYFREFASYTKDGSWTKTMQNSQKTLKKL
SEQHQTGLMADFVEVSGSNLNVAATKANQIASKHDNQYGFNACRIPWRVAYDYQLNHSQV
SKTVGTKLNHFFEKQRKITAIYTLNGKRVENYENTAFSAPVVYSAEVLNNQVLKNRYKKV
LTTPIPSGDYYPATIQMLVLLAGGSDK

Enzyme Prediction     

No EC number prediction in MGYG000004788_00230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	46	382	3.7e-77	0.990625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.43e-33	41	382	1	318	Glycosyl hydrolases family 8.
COG3405	BcsZ	6.07e-13	38	292	16	254	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.54e-05	74	285	51	249	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO45419.1	9.80e-279	1	387	1	387
QMT85170.1	6.08e-213	2	387	1	386
QCX23692.1	6.07e-207	2	385	1	384
AKS52569.1	1.34e-197	23	387	1	365
AKP04262.1	1.34e-197	23	387	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	2.86e-49	29	381	45	400	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	2.40e-38	43	350	30	345	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	2.90e-38	43	350	36	351	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1CEM_A	1.39e-30	30	371	14	337	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	9.67e-30	30	371	14	337	ChainA, Endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	2.19e-48	29	381	45	400	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	6.03e-34	41	342	84	393	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37699	9.07e-31	39	381	58	383	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2
A3DC29	9.10e-29	30	371	46	369	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37701	1.43e-28	40	381	59	383	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999452	0.000116	0.000047	0.000001	0.000001	0.000425

TMHMM  Annotations     

start	end
7	29