CAZyme Information: MGYG000004788_01017

Basic Information

• Species: Companilactobacillus farciminis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Companilactobacillus; Companilactobacillus farciminis
• CAZyme ID: MGYG000004788_01017
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	MGYG000004788_15|CGC1	51020.23	8.6681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004788	2403188	MAG	China	Asia

• Gene Location: Start: 12682; End: 14010 Strand: -

Full Sequence      

MKNIFIDHIAGSTTLGTVINICLLILCLYPIIGSFFWFSGALCYRFLKKNKYDDNWENIP
PNKQPMITIMIPAHNEEVVIEETITYLFNELNYQNFEVLVTNDGSTDTTQEILERLQLTY
PKLRVINIVKNKGKAHAFNIGMHFAKGEYILSNDADTIPEPDALMKYMNFFIHNRDMNTS
AVTANMDVQNRSTMLGKSQTVEFSSIVGTIKRSQTSINDSMYAYSGANTLYKKDFLIDVG
GFRQDRATEDISIAWDHQTIGAVPRFAPNIVFHMNVPESISQLYKQRKRWAQGGTEVWLT
NLKKFLFHPIKRRYQMSMFIDSSLSIIWSFFFVITSVIFFITMLWFFFQGDFERIFHAFV
ISFIFVTFELIAGCFQLFTALLLDHHGAKLKYAFFAPLYMLFYWIINPITVVMTFIPAVK
TILGFGSGTWTSPKRSSLQNNK

Enzyme Prediction     

No EC number prediction in MGYG000004788_01017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	68	239	3.4e-31	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	7.55e-105	18	435	6	416	N-glycosyltransferase; Provisional
PRK14583	hmsR	6.69e-66	20	435	28	437	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	5.05e-56	13	432	2	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.05e-53	69	250	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	1.29e-27	68	236	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO45676.1	0.0	1	442	1	442
QMT83299.1	1.63e-314	1	442	1	442
AKP03227.1	1.34e-313	1	442	1	442
AKS51527.1	1.34e-313	1	442	1	442
QCX23951.1	7.74e-313	1	442	1	442

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	3.92e-13	38	278	14	250	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	3.94e-13	38	278	15	251	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
2Z87_A	5.76e-11	44	195	357	501	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	5.77e-11	44	195	358	502	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
6P61_A	1.36e-10	63	181	11	127	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	2.44e-55	29	439	10	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	5.03e-54	29	439	10	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q6GDD8	1.57e-50	29	439	10	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.57e-50	29	439	10	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	1.57e-50	29	439	10	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000001	0.000044	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
16	38
326	348
361	383
393	415