CAZyme Information: MGYG000004788_01927

Basic Information

• Species: Companilactobacillus farciminis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Companilactobacillus; Companilactobacillus farciminis
• CAZyme ID: MGYG000004788_01927
• CAZy Family: GH65
• CAZyme Description: Trehalose 6-phosphate phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000004788_47|CGC1	39522.62	4.5477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004788	2403188	MAG	China	Asia

• Gene Location: Start: 9410; End: 10432 Strand: +

Full Sequence      

MEQYGLEMLLQIAKFWIDMADFDEKTGKYSIENVMGPDEFHEGYPGNDDGGLKNNAYTNI
MVSWLFKQITKMLHTQPIDSVKDNLKRTDFNPDYLDKMNSIRHNLNLDFEDDILGQFEGY
FDLKELDFEKYRQQYGNISRMDRILKAHNDSPDNYKVAKQADTLMALFNIRENDFLDIMK
DLGYPINNPNKFISDNIQYYIQRTTHGSTLSRIVYSMLLLKVNDDKQAWKLFYEALTSDY
YDIQGGTTAEGIHLGVMGATLNVVTSYFAGIDYRGDQLQINPHMPKQWEKISFNMLFKGV
KFSFEVTQDTITIVTDKDTEVQFIGKDLPLTANQEIELTY

Enzyme Prediction     

EC	2.4.1.282	2.4.1.216

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	1	275	5.4e-69	0.6532258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03632	Glyco_hydro_65m	3.94e-70	1	278	138	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
COG1554	ATH1	2.57e-66	1	306	456	733	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
PRK13807	PRK13807	1.52e-28	1	338	447	756	maltose phosphorylase; Provisional
pfam03633	Glyco_hydro_65C	9.34e-07	282	323	1	42	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.
COG3459	COG3459	1.13e-04	244	338	958	1052	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO46818.1	2.87e-245	1	340	560	899
AKP02197.1	1.83e-233	1	340	560	899
QMT83695.1	1.83e-233	1	340	560	899
AKS50494.1	1.83e-233	1	340	560	899
QCX25129.1	1.45e-227	1	340	560	899

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIQ_A	1.80e-37	4	313	448	736	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	8.13e-28	4	318	440	736	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	2.01e-27	4	318	440	736	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9CID5	4.71e-80	5	332	447	760	Trehalose 6-phosphate phosphorylase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=trePP PE=1 SV=3
P9WN15	1.77e-69	5	338	989	1323	Uncharacterized glycosyl hydrolase Rv2006 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2006 PE=1 SV=1
P9WN14	1.77e-69	5	338	989	1323	Uncharacterized glycosyl hydrolase MT2062 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2062 PE=2 SV=1
Q8RBL8	3.99e-37	1	330	460	771	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1
Q8L163	7.46e-37	1	330	463	774	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004788_01927.