CAZyme Information: MGYG000004789_00386

Basic Information

• Species: Streptococcus sp001556435
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp001556435
• CAZyme ID: MGYG000004789_00386
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		39631.63	8.3275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004789	2137490	MAG	China	Asia

• Gene Location: Start: 44329; End: 45399 Strand: -

Full Sequence      

MAKAKKIVFTGGGTVGHVTLNLILIPKFLKDGWEVHYIGDKHGIEHEQIDKSGLDVTFHS
IATGKLRRYFSWQNMLDVFKVGWGILQSIAIIAKIRPQALFSKGGFVSVPPVIASKLLGV
PVYVHESDLSMGLANKIAYKFATTMFTTFEQSKGLAKTKHIGAITKVGMATSNQSDALDK
IKVHFDDKLKTVLFIGGSAGAKVFNDFISNTPQLTEKYNVINISGDSSLNTLERHLYRVD
YVTDLYQPLMDTADLVVTRGGSNTIFELLAMKKLHLIIPLGKEASRGDQLENAAYFERKG
YARQLQEAELSWETLNHELEQLVEHAETYKEAMAKSEEITSPDDFYNLLVTSISKK

Enzyme Prediction     

No EC number prediction in MGYG000004789_00386.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	191	343	1.4e-29	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.27e-136	5	356	2	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	1.11e-103	5	349	1	348	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	6.19e-98	5	335	2	335	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	1.01e-76	6	343	1	342	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	1.94e-64	5	348	1	344	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC48061.1	2.71e-258	1	356	1	356
ARC34123.1	1.56e-257	1	356	1	356
ARI60345.1	1.06e-255	1	356	1	356
SQF76188.1	1.06e-255	1	356	1	356
CCB95110.1	3.03e-255	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	3.24e-22	3	311	5	311	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	2.14e-21	6	343	4	342	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	2.19e-17	2	316	7	327	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5M0D4	7.43e-241	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus thermophilus (strain CNRZ 1066) OX=299768 GN=murG PE=3 SV=1
Q5M4Y1	7.43e-241	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) OX=264199 GN=murG PE=3 SV=1
Q03L97	2.13e-240	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) OX=322159 GN=murG PE=3 SV=1
Q8E6P0	3.95e-195	5	355	3	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=murG PE=3 SV=1
Q3K2P3	3.95e-195	5	355	3	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004789_00386.