CAZyme Information: MGYG000004789_01339

Basic Information

• Species: Streptococcus sp001556435
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp001556435
• CAZyme ID: MGYG000004789_01339
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MGYG000004789_38|CGC1	49980.28	4.4345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004789	2137490	MAG	China	Asia

• Gene Location: Start: 9888; End: 11186 Strand: +

Full Sequence      

MLIIAQEPSQATEKLRRLLDSFGIQSRVFYTNFETDIDKDTISLASSFIYSSEEDYQGKP
LFFNDLSVPLYWELWTLGITTYIFDGQDRRASVIFRDNLKERTVKQVQWFGQGEKVVAID
DYNRYGWRTKQRLLDDQGQGIMDIYFNRNQEEALLHYIQDGYLIDQGSEGRDRIFSGREE
LTKVVLNQILKSDEAIICMDSNLIPILKTLNANRLVYCSDSHDGLEFIQSQVNHVLITNY
YPQEERWSGMIYLAGAKQEGSQTFVPQAMVMTASENIEGLADLVDAFPDIDFHIGAQTSM
GPKLTCLEDKGNVHLYPGIRQEKYQELLRKCFIYLDLNYGSEVSDATLDAIENGQLLYGL
ESTVHRHYYKGLPTVYTSLEELEQDFRQLLQQPEFYPKALESQKEVLKLAEREEILAFFT
RLKGEEDDNLHL

Enzyme Prediction     

No EC number prediction in MGYG000004789_01339.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02919	TIGR02919	5.29e-50	18	366	4	383	accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC23040.1	1.17e-317	1	432	1	432
CCB96003.1	5.86e-317	1	432	1	432
ARC49142.1	6.33e-316	1	432	1	432
ARC33121.1	1.27e-306	1	432	1	432
ALR80555.1	3.48e-304	1	432	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9U_B	1.42e-23	9	368	9	389	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
5E9T_B	1.43e-23	9	368	9	389	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_D Crystal structure of GtfA/B complex [Streptococcus gordonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0S4NND9	2.15e-30	59	365	56	379	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtfB PE=3 SV=1
Q3S2Y1	1.44e-29	50	365	48	383	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus agalactiae OX=1311 GN=gtfB PE=1 SV=1
A0A0H2UR90	7.74e-27	50	380	48	398	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfB PE=1 SV=1
A1C3M0	3.46e-24	44	372	41	392	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus parasanguinis OX=1318 GN=gtfB PE=1 SV=1
Q79T00	7.05e-24	9	368	9	389	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus gordonii OX=1302 GN=gtfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004789_01339.