CAZyme Information: MGYG000004790_00656

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000004790_00656
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000004790_13|CGC1	43109.47	8.5264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004790	1700914	MAG	Denmark	Europe

• Gene Location: Start: 27155; End: 28306 Strand: -

Full Sequence      

MRYYIIAGEASGDLHGSNLIRGLAAEDGAAQLRFWGGDMMLAAARENGIPAELVRHYRDG
AVMGFTEVLAKGRRLLRNVEFCKSDILVWKPDVVVLIDYPGFNMKIAEFCHRHGIRVFYY
IAPKTWASREGRNRKLKAWVDRLFIVFPFEKEYFSSRGISYVYEGNPLVDAVDSHEFVRP
VEGPYIALLAGSRKAEISRTMPVCMELADRLSALPRYEGYKFVVAGAPARTREDYQQYIG
SRTNVELMFDRTYDILKFADAAVVNSGTASLEAALIGTPQVVCWSTSPLTYFVAKNVLRV
GDHIRYISLGNLCIDRQAFRELIQEDFNIEEVLAEVRRLNEDQAYRSRMLADYAAIRESL
GGSGASRKVAAAMIRELRAGGAR

Enzyme Prediction     

No EC number prediction in MGYG000004790_00656.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	1.7e-99	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.62e-97	1	372	2	370	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.52e-95	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.63e-67	4	374	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.52e-58	5	374	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.20e-52	58	370	46	341	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW75777.1	3.74e-109	1	375	1	366
AZA48355.1	3.44e-107	1	370	1	361
AZA63288.1	3.44e-107	1	370	1	361
ANF51148.1	9.76e-107	1	366	1	357
ALR31450.1	9.76e-107	1	375	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.00e-34	5	334	11	339	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.00e-34	5	334	11	339	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	9.98e-68	2	377	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	1.10e-66	2	377	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	6.50e-65	2	370	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	2.17e-62	2	380	6	381	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.93e-59	5	370	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004790_00656.