CAZyme Information: MGYG000004792_00270

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004792_00270
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198	MGYG000004792_2|CGC2	21680.61	5.6051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004792	1933522	MAG	China	Asia

• Gene Location: Start: 63961; End: 64557 Strand: +

Full Sequence      

MNTKKNFVKAFATLGAVALGVTSTAVVANADMVYTVKSGDTLSSISYKFAKDNSLINEIA
KDNNLSDVNHLQVGQKLLIKGDGEISTMNTQNTQATQTNNAQQNKDNTTGDNTADKASQS
NNLSSAEQAAKEWIAQHESGGSYTAQNGRYYGRYQLDLSYLGGDLSPQHQEEVAQQYMQN
RYGSWQAAQAHWEANGWW

Enzyme Prediction     

No EC number prediction in MGYG000004792_00270.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01476	LysM	1.05e-10	34	80	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.89e-10	33	79	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	3.16e-10	34	79	2	44	Lysin motif.
COG1388	LysM	3.73e-05	20	90	55	121	LysM repeat [Cell wall/membrane/envelope biogenesis].
cd13925	RPF	3.79e-05	132	187	4	70	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN93534.1	1.38e-122	1	198	1	198
AMS09948.1	1.05e-97	1	198	1	191
QFG72230.1	3.36e-60	1	197	1	187
QLQ62277.1	3.47e-60	1	197	1	199
QLL75526.1	3.47e-60	1	197	1	199

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999143	0.000157	0.000180	0.000152	0.000139

TMHMM  Annotations     

start	end
7	29