CAZyme Information: MGYG000004792_01302

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004792_01302
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	MGYG000004792_18|CGC2	48481.64	8.8803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004792	1933522	MAG	China	Asia

• Gene Location: Start: 27333; End: 28598 Strand: +

Full Sequence      

MISLLIFLIYTLISIFFRSFSYPTDYIAFAGNQVTDKVDKQLRYFIIVPCFNEEAVIKQT
IQHLLGFGEFEVVVVDDASTDNSAAEIRQIRSLPLHLLQRQLPDAHTGKGDVLNFALDYI
RQQIKQRGTTPEKTIVGVVDADAELAPNAAQRLNGDFSSPAGNVCQMRVKMYPHFKTELQ
ILQDIEFFSINHMTQIMRMYTRTVGLSGNGQFFRLAPILAKIGPHPWGNALLDDYELTIK
MLLKGLHVDYMTETYVYQEALASLKKFIRQRSLWVQGDLNCLKYLPAIVKSRRLKTTQKT
GIYYFLCQPWINALADTAIIVLTVFSFFHLDKLFGNLPGLALIAMVVLVALFSLLWGIVF
SFFYRHDLRHFDEPAITRRQYLLLPFGVSYLYVVLFFSIVMAFWRWLFHENSWIKTEHGK
G

Enzyme Prediction     

No EC number prediction in MGYG000004792_01302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	44	275	8.6e-25	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06436	GlcNAc-1-P_transferase	5.33e-84	46	234	1	191	N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine. N-acetyl-glucosamine transferase is responsible for the synthesis of bacteria Poly-beta-1,6-N-acetyl-D-glucosamine (PGA). Poly-beta-1,6-N-acetyl-D-glucosamine is a homopolymer that serves as an adhesion for the maintenance of biofilm structural stability in diverse eubacteria. N-acetyl-glucosamine transferase is the product of gene pgaC. Genetic analysis indicated that all four genes of the pgaABCD locus were required for the PGA production, pgaC being a glycosyltransferase.
cd06423	CESA_like	6.75e-30	46	223	1	170	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	9.94e-30	1	408	16	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.79e-18	43	277	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06438	EpsO_like	2.17e-15	46	237	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXX74031.1	1.77e-204	2	420	12	430
QDR73197.1	1.45e-203	2	420	12	430
QQR15294.1	2.05e-203	2	420	12	430
ANU50764.1	2.05e-203	2	420	12	430
QBE46855.1	2.13e-203	2	420	12	430

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	9.96e-06	46	313	79	333	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991617	0.008319	0.000028	0.000015	0.000010	0.000020

TMHMM  Annotations     

start	end
4	22
302	324
339	361
382	404