CAZyme Information: MGYG000004792_01501

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004792_01501
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		61083.82	5.9026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004792	1933522	MAG	China	Asia

• Gene Location: Start: 7986; End: 9611 Strand: +

Full Sequence      

MMNEQFFLQTPQLVTVVNDNGRTSKQWQGQQTTVAETKVTYDLTAQGVAVKISSAVPVSF
VRLRWEHHFDSRAQFLADEVERGYGTMGWQKLTPNRIMPWYFMENHGDTTTGYGVMTQPN
AFCFWQADPAGITLIMDVRNGGSSVELGDRQLTLATVVSEKYAHVTSFVATQRFCHLMSP
HPVLPKEPVYGSNNWYYAYGRSSAKEIVSDTAYLKGLTAGIANRPFMVIDDGWQVDHVID
GYNGGPWRAGNAAFPDMGALAQEIVDQDVKPGIWFRPLLDHREEIPDSWRNPLNGALDPT
VPAVLDRVKGDVAQLCKWGYQLIKHDFTTFDLFGRWGFQMRPFVTTDGWHFFNRTLTNAE
VVKQLYQAIYSTAAHYHTLILGCNTVGHLGAGLMQLARIGDDTSGKVWERTRQIGINSLA
FRLPQDQAFFSIDADCVGITEQIDWHYNRQWAQLVAESGTVLFISAVPGILTADQRQELH
ESLVLAAQQTSHFTPQDWQLIDCPAEWVSGNQVRHYDWYEPAGIQFCNDTPRSIPFYSIA
H

Enzyme Prediction     

No EC number prediction in MGYG000004792_01501.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.08e-34	187	481	1	292	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	2.97e-07	158	324	270	436	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	9.41e-07	158	315	19	178	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14790	GH_D	0.009	220	441	26	208	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU96820.1	6.78e-200	8	539	8	543
ATO42382.1	6.38e-194	53	537	7	495
AFU70663.1	2.22e-193	36	537	44	541
QYN59697.1	2.22e-193	47	537	44	541
AIC91315.1	2.55e-192	49	539	46	544

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004792_01501.