CAZyme Information: MGYG000004793_00761

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; UBA1820; UBA1820
• CAZyme ID: MGYG000004793_00761
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36245.81	5.2766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004793	1486801	MAG	China	Asia

• Gene Location: Start: 1264; End: 2220 Strand: -

Full Sequence      

MTENYENYNWFERYDTWTEPCAIIDSYLTAVQLWMKTRNPAYLEDAEKIYLNGIASTQRA
NGGFGCDKPTGVDYHHLAIHADEAYWCCTMRGGEGLGRVAEYSYFTAGDTLFIPFYRESS
LELKDRELALTQSTDYPFGSRVEFTLEKAPDREMSLAFFIPSYMNDTLRVNGEKVTANKK
DGFAVLTRRFSTGDKIELDYAFTTSWQPLANKDISDTTLRKALYGPLVLGAKTTEPLIVP
ENTLPPVRIGNRYEFLIEETGDTLKPLYHLMDPSVSLKNKYHREVIAAPAGTNPFARMES
LRRTNTLHPDASQNQEKK

Enzyme Prediction     

No EC number prediction in MGYG000004793_00761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	18	229	6e-32	0.4194831013916501

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	9.95e-31	16	240	289	516	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	1.69e-30	19	229	290	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23470.1	9.13e-114	1	285	288	573
BCI61757.1	2.27e-75	1	275	287	563
QGQ98268.1	2.34e-46	1	251	257	514
ARS40685.1	2.37e-21	19	251	328	559
APC42636.1	5.71e-21	12	231	282	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.92e-16	39	233	365	563	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.58e-16	39	233	365	563	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5MQO_A	1.72e-10	19	198	381	575	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004793_00761.