CAZyme Information: MGYG000004795_00694

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-877
• CAZyme ID: MGYG000004795_00694
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000004795_10|CGC1	63829.71	9.9441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004795	1190369	MAG	Mexico	North America

• Gene Location: Start: 28981; End: 30633 Strand: +

Full Sequence      

MMSIKKILNTKNKKMDKIDFIILSVIIAFYSVLSFINLGTTSSPWTFLTLNKEEEITLKL
KDKEKVENIKFFNGNLSGTYKITSSTNNIDYNYIATYKGNGAFSWNDEKLKANAKYLKIK
SLQKSTLGSVTLYDNNLNKIAIDKVISKNKNKNNLIDEQRKTPKKINYLNSSYFDEIYFA
RTAYEYANGLKAYDWVHPPLGKLIQAIPIKIFNNMSPFFYRLVSNICGILMIVIMYLFCK
QMFLQRKFSILGALLMTFDTFHFVQTRIGTIDSILVLFILLSYFFMYKYISESNEKHLMF
SGLFFGCATSVKWIGLFAGLGLAIIFFTHVIKNKLISIKLLLKCCVFYILIPFVIYIGSY
LLFPNVENTYTNSIENIVIQTKNMYKYHSTLNAKHPFSSKWYTWIVTYKPVWYYQGEVSN
NSHGTIVALGNIAIYWLGLITLLYTIGKMIIKKDKNSFFIVVGALSLYLPYIFIGRCMFL
YHFFPVLPFVMLSIVNLFNDLCKKIKNNIFMYVYIAIVILVFIIYYPAISGIKVSNSYLD
SIKLFDTWIF

Enzyme Prediction     

No EC number prediction in MGYG000004795_00694.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	165	362	3.3e-49	0.9327354260089686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02366	PMT	2.06e-21	165	362	14	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	6.18e-21	165	360	41	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	3.97e-19	384	546	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	3.74e-16	371	550	495	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	2.97e-15	196	356	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH68061.1	8.66e-117	26	548	22	556
ADZ82369.1	8.82e-116	26	548	19	553
QUI22495.1	1.68e-90	1	550	388	969
BCN30459.1	4.27e-88	8	549	480	1057
QGQ95357.1	1.82e-86	14	550	688	1279

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999899	0.000107	0.000001	0.000000	0.000000	0.000026

TMHMM  Annotations     

start	end
20	42
217	239
268	290
305	327
340	362
424	446
458	475
479	498
510	532