CAZyme Information: MGYG000004797_00025

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_00025
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000004797_1|CGC1	53225.97	6.8581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 44675; End: 46090 Strand: +

Full Sequence      

MNLKTLSMMGALLLLAGTGVNAQKKKEVLNDSNTPLHLLQPAYKVPYGMLTTEEIKADMD
RVLRYLERNTPARVVDKNTGKVITDYANMTADAQLERGAFRLASYEWGVTYSAMLAAAEA
TGDQAYYKYVTDRFQFLAEVAPHFRKVLEKYGTVDPQMKQILTPHALDDAGAVCAAMVKV
QMKKNSPELKPLIDNYMDFIVNKEYRLADGTFARTRPQHNTLWLDDMFMGIPPVAWYSCI
AGDKKQMYLSEAVRQIFQFADRMWVPGKNLFRHGWVEGMQDHPAFHWGRANGWALLTMCE
VLDVLPEDYPQRDKILELFRAHVRGLAACQSGEGFWHQLLDRNDSYLETSATAIYVYCFA
HAINKGWIDAMAYGPVAQLGWHAVTTQINAEGQVDGTCVGTGMAFDPAFYYYRPVNVYAA
HGYGPVLWAGAEMINLLNKQHPKMNDSAVQYYRTEQKTSEPIFHVMDGGTK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	100	434	2.4e-90	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.67e-97	65	437	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.37e-47	105	437	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT56860.1	0.0	1	471	1	471
ALK86405.1	0.0	1	471	1	471
QEW35585.1	0.0	1	471	1	471
ABR37879.1	0.0	1	471	1	471
QQY39787.1	0.0	1	471	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.40e-245	25	465	2	442	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	1.99e-23	186	416	127	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.70e-21	191	416	133	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
1NC5_A	2.44e-17	105	433	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.77e-17	105	433	31	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.22e-18	223	434	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.33e-16	105	433	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	2.47e-16	244	434	152	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	3.49e-15	181	436	119	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001220	0.941648	0.056303	0.000319	0.000253	0.000211

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_00025.