CAZyme Information: MGYG000004797_00045

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_00045
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	MGYG000004797_1|CGC2	73474.39	7.4419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 72298; End: 74232 Strand: +

Full Sequence      

MKRLYIGALWMVFSLSILQAKEIKMSSPDGKYQFTLSDEGGNLHYSLNWNAKETIKPSLL
GIKANAVWRDHLSLGDMTTAEQDTVWHPVYGERSTIKDQYKAWSVVINRQNSRDKLVLDV
RAYNEGVAFRYRFPGGQYLKITDEFTEYTLPEGAKAYFTSRAQTPYEYLPLEGWPGESDR
PLLLTLPEGPYVCLAEAQVVDYVRTKFKLSTEKKNTIQSAMYGPVEDIAPYHTPWRVIMC
ADKPGQILEHNDLILNLNPSCKIKDTSWIKPGKVMREVTLTTEGGKALVDFAVKRNLQYI
HFDAGWYGFEYDKASDATTVTLDPRRNPDINALNLKEVVAYAKERGIGVILYVNQRALQQ
QLDEILPLYKSWGIAGIKFGFVQVGSQVWTKWMHEAVKKCADYGLMVDIHDEYRPTGFSR
TYPNLMTQEGIRGNEEFPDATHNVTLPFTRFIAGAADYTICYYRQDFGRLNADKDSYGVP
RSKSIQTTPAHQLALAAVYYSPLQYMYWYDKPSDAQDEPELKFFDDVYTTWDDTKVLQGE
VGEFITIARRKGEEWFIGSITNNEARALSVSLDFLPEGKNYIAEIYTDGDTSVKTRTKVR
VSTYRVSNKTRLNFCLKASGGSAVRLVPDDGNIKSVKNYKQQRL

Enzyme Prediction     

No EC number prediction in MGYG000004797_00045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	13	626	1.3e-184	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.08e-70	265	527	1	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.00e-59	27	259	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	5.11e-42	531	627	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT56878.1	0.0	1	644	1	644
QQY40417.1	0.0	1	644	1	644
ABR37863.1	0.0	1	644	1	644
AND21694.1	0.0	1	644	1	644
QUT85455.1	0.0	1	644	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQC_A	2.74e-66	25	625	3	657	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	3.79e-66	25	625	3	657	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5E1Q_A	4.07e-66	27	626	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQB_A	1.01e-65	25	625	3	657	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3A24_A	3.08e-65	27	626	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.36e-67	1	626	1	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	2.41e-64	1	637	1	736	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	2.41e-46	26	623	44	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999047	0.000201	0.000169	0.000160	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_00045.