CAZyme Information: MGYG000004797_00336

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_00336
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
907	MGYG000004797_3|CGC3	103174.99	5.8848

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 44361; End: 47084 Strand: +

Full Sequence      

MKNNKKLCFAILSLLLLIGNVSLAAKEKKYVLSSPDGTLKVEISTGNELAYQVMHGNDTI
LSHSNIALVLEDGTIVGKTPRITGERRKKIKDNIESPFYRFKEFVATGNELDLKLKGGFG
IIFRAYNEGVAYRFYTTQSSDIIIKDEQAEFNFNKDYMAYLPYTTNDKKPMAMAFQNVYD
ITPLSKAQPKLAFLPVTVDCGSVKLTLLESDLEAYPGMFVQSQQGKYGLKGVFAPYPAKT
DFYPWRKQEYVTETTDFISRSCGSRSYPWRVLAITEKDTDMPVNNLVYALASPNRIGDTS
WIKTGKVAWDWWNDWNLKGVPFKAGINMDTYKYYIDFASRNGLEFIVLDEGWYAPKSGDM
LTVIPELDLPELIAYGKSKGVEIVLWTVFNVLDSQLEAACKKYADMGIKGFKVDFLDRDD
QTAVEMVYRIAEMTARYKLTLDLHGIYKPTGINRTYPHIINFESVFGMEEVKWTDIKNNM
PLYDVTFPYIRMMAGPVDYTPGAMRNATKADWRAMYYTPASMGTRCHQLAAYIVHDSPFT
MLCDAPTNYLNEQECVDFMASLPVEVDSTFIASGELGKYIVTVRKKDVNWYIGGMTNWDE
RDVQLDFSFLPEGMSYTAVLFKDGVNANKQAEDYRKETIRINKDSRLTLHLASGGGFAMK
LELCPVHGQITGIPEGKNIPSFYQKYIETEGLYVTSSGKVSDEALLKACDIISLMLAKRP
DVKAHMVKKGCHVMVIGKDEETCDLPEFAHICNCEDSIKYWNWRARGFGGAPEDEFSSSC
GEENLLALPQDKYAGENILIHEFAHLIHTVGIVGVEPGFNERLEALRQHAIRKGLWEKTY
AVSNKEEYFAECVQSFFNCNRYAEPANGVHNWVNRRTKLKTYDPDMYRLLQEYFYEIEIP
IHNVVHE

Enzyme Prediction     

No EC number prediction in MGYG000004797_00336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	22	661	1.1e-190	0.9873217115689382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	7.57e-135	298	563	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	6.19e-59	34	293	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	6.45e-41	567	661	2	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd20169	Peptidase_M90_mtfA	4.10e-07	795	894	110	208	Mlc titration factor A (MtfA) is a zinc metallopeptidase (M90 peptidase). This subfamily includes the Mlc Titration Factor A (MtfA; also known as YeeI or DgsA anti-repressor MtfA) which is involved in the control of the glucose-phosphotransferase sensory and regulatory system by inactivation of the repressor Mlc (making large colonies). It can cleave synthetic substrates of both carboxypeptidases and aminopeptidases, with strongest activity towards the latter. Its biologically relevant substrate has yet to be identified. Although it interacts with the transcription repressor Mlc, it does not cleave it. However, Mlc seems to activate the peptidase activity of MtfA. MtfA is related to the catalytic domain of the anthrax lethal factor which is a zinc-dependent metalloprotease, targeting mitogen-activated protein kinase kinases (MAPKKs), and resulting in apoptosis, as well as the Mop (modulation of pathogenesis) protein involved in the virulence of Vibrio cholerae; although sequence similarity is low, conservation is observed in the overall structure as well as in the residues around the active site.
cd20170	Peptidase_M90-like	2.09e-04	789	890	112	205	uncharacterized M90 peptidase family-like proteins. This subfamily contains uncharacterized M90 peptidase-like domains, similar to the Mlc Titration Factor A (MtfA) peptidase from Escherichia coli, also known as the YeeI gene product, which is involved in the control of the glucose-phosphotransferase sensory and regulatory system by inactivation of the repressor Mlc (making large colonies). E. coli MtfA has been shown to have aminopeptidase activity with the presence of a single zinc ion in the active site ligated by two histidines in an HEXXH motif. MtfA is related to the catalytic domain of the anthrax lethal factor and the Mop protein involved in the virulence of Vibrio cholerae; although sequence similarity is low, conservation is observed in the overall structure as well as in the residues around the active site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT86594.1	0.0	1	907	1	907
QEW34704.1	0.0	1	907	1	907
ABR38815.1	0.0	1	907	1	907
QQY38934.1	0.0	1	907	1	907
QQY42155.1	0.0	1	907	1	907

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	7.59e-209	34	662	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	4.87e-208	27	662	13	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	1.77e-59	34	667	5	664	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	4.48e-59	34	667	5	664	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.13e-58	34	667	5	664	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	4.15e-211	5	662	2	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	7.20e-46	33	594	44	561	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	6.01e-42	11	662	6	724	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000879	0.998142	0.000314	0.000231	0.000222	0.000207

TMHMM  Annotations     

start	end
7	24