CAZyme Information: MGYG000004797_00348

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_00348
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	MGYG000004797_3|CGC3	56855.92	6.0334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 72052; End: 73593 Strand: +

Full Sequence      

MKKMKSLLAGACAAVLLCSCSGTGSVQTTEKGTQWQWEKGTVVVKNPGRPAGQESVIGLA
LPKMEVVRVGFVGLGMRGPGAVERFTYIPGTQIVALCDYEPERAERCQQYLKNASMPKAA
VYSGEKGYEELCKREDIDLVYIAADWLHHFPIAKCALENNKNVAIEVPSAMNLKECWELV
DLSEKNRKHCMILENCCYDWFEMNTLNMAQQGVFGEVIRAQGAYIHNLAPFWKHYWKNGE
EDKLGWRLEYNMRHRGDVYATHGLGPVAQALDIHRGDRMETLTAMDTKSVVGKALAEAAT
DSACNSFRNGDHTTTMIRTANGKVIEIQHNVMTPQPYNRLYQLTGTKGFANKYPVEGYAL
DADQLVASGVQPKIDDLNSHGFLPDAEMAALVEKYRHPILTKYGEMAKEVGGHGGMDFIM
DSRLVYCLQNGLPLDMDVYDLAEWCCLAELGELSMDNGCAAVAFPDFTRGEWNKVRGYSH
AYAAPADEAAAMEKAKAFTAALKERGAKEWAAE

Enzyme Prediction     

No EC number prediction in MGYG000004797_00348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	474	7.9e-158	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	COG0673	5.86e-23	64	396	1	306	MviM Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.31e-13	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	4.85e-04	65	217	3	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU07042.1	0.0	1	512	1	511
QQT78254.1	0.0	1	512	1	511
QRP56502.1	0.0	1	512	1	511
ASM65218.1	0.0	1	512	1	511
QUT44459.1	0.0	1	510	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	7.34e-82	49	472	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	8.58e-66	67	476	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	3.02e-08	66	217	12	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3E9M_A	8.18e-08	103	305	39	214	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	513	1	513	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	513	1	514	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	8.23e-237	3	504	2	499	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	2.55e-201	4	483	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
P0C863	4.62e-201	47	483	34	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_00348.