CAZyme Information: MGYG000004797_01526

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_01526
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1013	MGYG000004797_17|CGC1	115063.15	6.983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 30129; End: 33170 Strand: -

Full Sequence      

MKLLNIVNRKILFTVFGVLVNVSWGISQERNTINLSETLWNITLDRSAVWQNDSLYVPPV
NIHDLPVHIPTGGWNLLDTPDKIGVTLPATIEQHLWGWNGETFGVTGNYVGVSWFDTKIN
VPADWRNKRIVMNVASVRFRAEIFVNKKLVGYDLVNSTPFAVDVTPFILPGQENVIAFRI
TDPNGNFNWKDSQVYTWGEYRTNPSHGFGGITGKVELVATDKLYIGDVFIKNQPDPHSIE
VEVTACNETKNPMKAQKMLLTVKEHKGEKVLYRKEYSVENLVVGENKQTFHIHLPAAKLW
STDSPHLYDLSVSVGTDNYTQRFGFRWFEVKDIHGDKQFFLNGKRIVLRTAISWSFWPDN
GITPSDELARRQVESAKKLGLNMLNFHRTIGHSNVLDYADELGLLYFEEPGGNQYPISHF
NDNNKQSKFYFAYRNEKLARMIKRDRNHPSLVIYNLHNERGAWPQVQDYAQMRMAHSLDP
TRILTYNSSNGENPENEANARFKLHLMPNDTTFYDYGWYDRHHAGGPGCYHDNLYLGKDN
YHRFSDHKDEIIYWGEDGAIGTPPRLQLIRDEILQSGTTSGWEAMDYMKWYDAYDSFLKH
NGFAKAFPTVDDLTRAMGNVAFYYQGRVIENIRISNTVDAYAVNGWESMKLENHSGIVDN
YRYPKGDVEVMARYNQPLFLAVKMNRKVLNVGDTTIVDTYIVNEKNLKGNYSLQLIAKDA
EGTVLATHVSSVHVKGGNVYGQCLQTGWNFVPRATGYVCIEAKLVKGKKTFATGDDSLFA
VSLNTKGITANGSIADTTGVLSNFMKTVGFDIPEYKEGIPSGDYLLVGAFEPTQWGSGMS
DIMEWVYKGHTLIIVDNAERWAEFLADKEVLDYRGSKKLGTAWYGGNFFNREHRIFDGLP
VNCVFNWEYQCFATYNRHRVGLRCFNGETLVACVSDHKKEVYSALSVIPAGRGKIIITTL
DIPACIKDVKAYTVPVDLDGMNESMNTFNTKSENRANVVGQQLLLNLIKESNR

Enzyme Prediction     

No EC number prediction in MGYG000004797_01526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	81	705	2e-77	0.6702127659574468

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.11e-37	61	602	26	548	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.52e-25	108	486	62	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	5.03e-19	121	486	119	474	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.31e-12	224	326	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	1.25e-10	328	495	1	168	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65142.1	0.0	10	1013	6	1009
QJR62726.1	0.0	10	1013	6	1009
QJR75369.1	0.0	10	1013	6	1009
ALA73626.1	0.0	10	1013	6	1009
QJR56769.1	0.0	10	1013	6	1009

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	4.39e-24	119	486	117	465	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.39e-24	119	486	118	466	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6ED1_A	5.61e-23	74	519	48	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6U7J_A	3.27e-21	108	459	72	417	UnculturedClostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
6ED2_A	6.06e-20	73	519	60	501	ChainA, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.40e-23	119	486	118	466	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KPJ7	1.64e-22	19	482	35	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	5.63e-22	108	482	53	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	1.92e-17	119	482	62	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P24131	8.32e-16	101	486	117	484	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.504069	0.486660	0.006775	0.000873	0.000609	0.001004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_01526.