CAZyme Information: MGYG000004797_01541

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_01541
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000004797_17|CGC1	35944.82	7.3428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 64175; End: 65128 Strand: -

Full Sequence      

MMRKVLGLLLLLVAVSGTWAQERRDTLVVSRDGTGDFRTLQEAVESARAFMDYTVTIYVK
NGVYKEKVIVPSWVENIDIIGEDRDKTIITYDDHANINKMGTFRTYTVKVEGSDITFKNL
TIENNAAQLGQAVALHTEGDRLKFINCRILGNQDTIYTGAKFTRLYFKDCYIDGTTDFIF
GPSTALFENCMIHSKRNSYVTAASTPKEAKYGYIFKHCKLTAEPGVDKVYLGRPWRPYAY
TLFIECELGKHIVPAGWHNWGKQSNEETARYMEYKNTGEGANVSERVAWSKQLTKKEAEA
VTVDAIFGTQSNWNPID

Enzyme Prediction     

No EC number prediction in MGYG000004797_01541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	306	2.9e-106	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	9.19e-84	21	299	1	288	pectinesterase
pfam01095	Pectinesterase	8.09e-79	28	303	3	291	Pectinesterase.
PLN02432	PLN02432	2.03e-72	27	313	13	291	putative pectinesterase
PLN02682	PLN02682	1.32e-71	26	310	70	365	pectinesterase family protein
COG4677	PemB	4.72e-67	25	307	81	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA73615.1	8.07e-231	2	317	1	316
QJR75357.1	8.07e-231	2	317	1	316
QJR56781.1	8.07e-231	2	317	1	316
AII67863.1	8.07e-231	2	317	1	316
AII65162.1	8.07e-231	2	317	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	9.42e-47	27	302	9	297	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	3.77e-45	28	289	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	2.42e-33	4	307	11	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	3.54e-33	27	286	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	1.64e-32	30	315	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.62e-60	29	298	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.69e-54	26	299	84	367	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	4.93e-54	24	313	270	572	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q8GXA1	7.35e-54	12	315	243	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q42608	2.15e-52	24	313	257	559	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000309	0.998917	0.000216	0.000183	0.000175	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_01541.