CAZyme Information: MGYG000004797_01542

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_01542
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000004797_17|CGC1	47084.72	7.2926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 65140; End: 66369 Strand: -

Full Sequence      

MKKNSICKIIVSGLFVAAPLMGMAQQVCGNKPWSVRMAESEMVRCPESWQLDFQTRLKWD
YCHGLELQAMLDVYDAYGDKKFFDYAVAYADTMIHQDGSIETYKLEEYNIDRLNSGKMLF
RIYEQTKDEKYKKALDLLRSQLDTHPRNADGGFWHKKIYENQMWLDGLYMGQPFYAEYAY
RNNRVNDYADIINQFVTVARHNYDPKTDLYRHACDVSKREKWADKTTGWSQHCWGRAMGW
YAMACVDVLDFIPEHEAGRESVIEILNKLAAQIKRTQDPATGVWYQVIDRSGDEGNYLES
SCSTMFVYTLLKALRKGYICPSYMEVAKKGYEGLLTQFIEVDNKGVVSITKGCAVAGLGG
KPVYRTGDYNYYITEKIRSNDAKAVGPFIMASLEWERLFQKSSCGTACK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	397	2.3e-121	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.36e-127	33	399	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.09e-104	53	399	28	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK82868.1	2.76e-312	1	409	1	409
ABR39473.1	1.12e-311	1	409	1	409
QQY38334.1	1.12e-311	1	409	1	409
QUT59627.1	1.12e-311	1	409	1	409
QQY41712.1	1.12e-311	1	409	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.00e-112	59	398	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.18e-77	58	402	38	371	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.91e-77	58	402	28	361	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	4.54e-21	147	398	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	1.02e-16	42	335	48	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.45e-77	58	402	38	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.36e-38	170	394	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.36e-38	170	394	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004643	0.992399	0.002059	0.000351	0.000273	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_01542.