CAZyme Information: MGYG000004797_01718

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_01718
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		24729.41	9.9655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 4460; End: 5113 Strand: -

Full Sequence      

MHNTILVIVAVLFTALSAHGQFNTISSRGHYGREIKAISTQSPYIKVSEPDSMMNGHQTE
EIQEIEKPVIAEAITDQKRNENKSEASAAKSPAQHIKEKKTSVIDDSNLPELTIPNLLAE
IKKNGIKYPKIVLAQAILETGWFKSSVCRNKHNLFGLTNPRTKTYYKFNHWTESVKAYYT
KVQYRYKGGNYLLWLRDIGYAEDKGYIRAIIKVLKQL

Enzyme Prediction     

No EC number prediction in MGYG000004797_01718.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	119	216	3.9e-18	0.921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.96e-14	115	179	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	4.74e-10	122	216	24	138	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	1.84e-09	122	217	59	182	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.42e-06	133	157	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	0.002	119	156	163	205	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35499.1	2.55e-66	107	217	96	206
QCD34777.1	4.23e-66	96	217	79	200
ANU62956.1	2.27e-65	96	217	77	198
QQR09706.1	2.27e-65	96	217	77	198
ASB36544.1	2.27e-65	96	217	77	198

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000209	0.999196	0.000149	0.000143	0.000137	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_01718.