CAZyme Information: MGYG000004797_02437

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_02437
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593	MGYG000004797_33|CGC1	66634.46	6.5504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 34401; End: 36182 Strand: -

Full Sequence      

MYMIKIKMVLALLGALLAGTVSAQIYIPPVFGKDSLDTRPDELSRLYIPPKRIMWVSHDS
LVQNKEVLLLSGNGQPELGKRNMCSMYTCGRDTASILLDYGRELHGGLKLVLGAARPWGT
QLVRVRFGESVSEACSEHDGGRRRKGYSTNDHAMRDITMKVPSDGQIEIGNTGFRFVRID
LLGSDAVIRLKEAPAVMRYRNIPYLGSFRCSDPRLNDIWMTGAYTVHLNMQEYLWDGIKR
DRVVWLGDMHPEVSTIMAVFGYNEVVDKSIDLACEQFPLPQWLNGMSAYSMWYLIIQYEW
YMHNGNLDYLRKHRDYITGLIDCIDSCVDEEGNESLAKSRFLDWPSTPNEAGVEAGYRAL
LCWALDDGVKLCDLLGEKGHAAKCNAIAGRLKKQIKQPNRLKQAAALMAVAGLMESERAC
DEIISVGGAKDFSTFYGYYMLQALAKAGEYQQALDIIRQYWGGMLDLGATTFWEDFNLDW
SRNAARLDDFVPEGKDDIHGDFGDYCYPGFRHSFCHGWASGPTPWMTRHVLGIEVLDAGC
KMIRVNPHLGDLEWAEGTYPTPLGVIYVKHVKKNDGNVVSTVKVPDGIKVVSK

Enzyme Prediction     

No EC number prediction in MGYG000004797_02437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	94	589	2.5e-98	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.59e-17	206	530	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.16e-04	532	585	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT59644.1	0.0	17	593	14	590
QDO68956.1	0.0	6	591	2	587
QUT69834.1	0.0	23	590	21	588
BCA48698.1	0.0	23	590	21	588
QUT42018.1	0.0	23	590	21	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	6.10e-47	96	568	194	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	3.20e-28	144	564	472	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	2.82e-14	95	528	94	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000507	0.998677	0.000183	0.000224	0.000191	0.000171

TMHMM  Annotations     

start	end
9	31