CAZyme Information: MGYG000004797_03080

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_03080
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	MGYG000004797_50|CGC1	88518.12	5.4947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 22411; End: 24765 Strand: +

Full Sequence      

MKMKKLLTLLLAVLLLAGCAGNQPGTFEAGKNTFLLNGKPFVVKAAEVHYPRIPREYWEH
RIEMCKALGMNTLCLYVFWNLHEETPGKYDFTGNKDIASFCKLAQKHGMYVIVRPGPYVC
AEWEMGGLPWWLLKNDSVQLRTLDPFYMQHVGAFMHEVGKQLQDLQITRGGNIIMVQVEN
EYGSYGTDKPYVSAIRDTVRAAGFTEVPLFQCDWSSNFLNNGLDDLLWTVNFGTGADIDK
QFAKLKEVRPDAPLMCSEFWSGWFDHWGRKHETRDGQIMVDGLKEMMDKGISFSLYMTHG
GTTFGWWGGANNPAYSAMCSSYDYDAPISEAGWTTDKYFALRDMLKDYLDEGQTLPEVPE
ALPVMEIPAIKFTQIAPLVDNLPEPKQTEEIRPMEKFDQGWGSILYRTDLPEDVKAGTVL
KITEQHDWTQVFADGKLLGRLDRRGGEQELTLPALKAGTQLDLLVEAMGRVNFDKSIHDR
KGITGKVELVNGKNAETLKGWTVYNLPVDYEFVSSRNFQDMNSSAACGIEKNDESIPAYY
RATFTLDKVADTFLNMESWGKGMVWVNGHAMGRFWEIGPQQTLFMPGCWLKKGVNEIIVL
DLKGPKEATIIGLNKPILDMLRVAVPETHRKQGQTIKLEKETPVAAGTFKPGNGWQEVKV
PATKGRYFCLEGLSSFDNTNIAAIAEFDVLDEKGQKISRENWKIVYADSEETRSGNRTAD
KIYDLQESTFWQTVDNTAYPHQVVIDLGKEYNVTGFRILPRAEQGAPGMMKDYKVYVKAT
GFGY

Enzyme Prediction     

No EC number prediction in MGYG000004797_03080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	34	346	1.3e-118	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.55e-152	33	346	1	316	Glycosyl hydrolases family 35.
COG1874	GanA	1.10e-42	33	612	7	600	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
PLN03059	PLN03059	2.28e-42	31	610	34	721	beta-galactosidase; Provisional
pfam02449	Glyco_hydro_42	4.57e-09	50	183	3	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam00754	F5_F8_type_C	1.28e-08	707	781	2	74	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK86780.1	0.0	1	784	1	784
QEW35199.1	0.0	3	784	1	782
QUT56492.1	0.0	3	784	1	782
ABR38205.1	0.0	3	784	1	782
QQY39504.1	0.0	3	784	1	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	4	782	3	777	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	1.93e-304	25	634	6	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	9.82e-147	32	628	22	599	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	5.74e-122	28	618	36	645	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3THC_A	5.79e-122	28	618	12	621	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	9.66e-125	7	585	9	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q60HF6	5.94e-123	5	618	7	644	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P16278	1.02e-122	5	618	7	644	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q5R7P4	1.10e-121	5	618	7	644	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q58D55	1.11e-121	5	630	6	650	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000090	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_03080.