CAZyme Information: MGYG000004797_03608

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_03608
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
970		108339.41	5.7053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 11944; End: 14856 Strand: +

Full Sequence      

MKRNIYSLLIIAFLSYWLTACSDKDRSQEASLDIDKESVDFGSDSGSQRITVTTNIDNWT
AKADKSWCHPSAEGKALRIDVDESEERYVRQATVTLTASGQIRKLTVRQLGYEASILVDK
SAFKIGVAGGEIRFAVTSNVNVAISLPEWITSKAAPRSPATVTTTYSYMVEATKTDNQRQ
GSIEITEILAGSSTKDGQSEEVTPKSTSISVIQKGLNEFAEGSGEDVNGDIKIKVTSGTA
SSFQPGSNIEKSFDEDYSTLYHSNWNNTASNYFPITLTYNFGALTDVDYLVYHPRSNGNN
GRFKEVEIDYSADGLTFTKLLDKDFQGSNHASKVTFDRSVQAKSFRFIIKSGSGDRQGFA
SCAEMEFFAKNPANFDYSTLFTDGSCSELKAGITDDDIARCEYPFFKNIAYYMMRGKYPS
EFRINEFKAYPDPDIQASTHKTYPYSLLDNPTGIAVKAGENLIVLVGDTHGYDIGLRIQN
LDAPNEDGFGGTAYLLNQGINKLTINEQGLVYVTYLTKTLDDPNATPIKIHFASGTVNGY
FDSQNPAHTRRWTELLGKATNRYFDVLGKYTHLTFETNDFRTYTGSDGEELINIFDQIDY
NEQVMLGLEKENKMFRNRLYLNVMYKAYMYATSYHTAYNRIVMKDICNPAKLKTSSCWGP
AHEMGHCNQIRPGVMWAGTTEVTTNIMSEYIQTVIFGQPSRLQVEDMGIVYRNRYSKAWN
AIIVAGSPHSDFRDIENHADDVFCKLVPFWQLELYFGKALGRTPLKQADRGGFYPSVYEY
ARNKNYSGMSNGDIQLDFVYACSKISGMNLLDFFSKWGFLTPVNKEVDDYGIKQMTVTPS
MIEALKQRVNALGLPTPDVALEYISDNTSELYRTKVEIIRGGNATHSPRTFTVGSGKNTV
TYHGETITIPDWKNVVTYEVKDGTGKFILISSGENAPSPTDTFTIPTGWKNGFKLYAVSA
TGKRVEVPVN

Enzyme Prediction     

No EC number prediction in MGYG000004797_03608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	238	365	8.6e-16	0.9274193548387096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	8.61e-45	552	818	18	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
pfam00754	F5_F8_type_C	1.35e-17	239	365	3	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd14948	BACON	1.97e-15	31	109	1	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	2.79e-08	32	112	2	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam18630	Peptidase_M60_C	1.45e-06	899	966	3	65	Peptidase M60 C-terminal domain. This is C-terminal domain (CTD) of M60-peptidases pfam13402. It Can also be found at the C-terminal region of gingipain B (RgpB) from P. gingivalis. It was found to possess a typical Ig-like fold encompassing seven antiparallel beta-strands organized in two beta-sheets, packed into a beta-sandwich structure that can spontaneously dimerize through C-terminal strand swapping. Translocation of gingipains from the periplasm across the OM is dependent on the conserved CTD, which appears to be important for secretion of the proteins and in particular, truncation of the last few C-terminal residues of this domain leads to accumulation of gingipains in the periplasm. Subsequently, the T9SS targeting signal was demonstrated to reside within the last 22 residues at the C-terminus of the CTD. During gingipain translocation across the OM, the CTD is cleaved off by PorU.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73117.1	0.0	1	970	1	968
QQA08808.1	0.0	1	970	1	968
QMW85440.1	0.0	1	970	1	968
QUT40967.1	0.0	1	970	1	968
QRP57133.1	0.0	3	970	2	958

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BLG_A	1.29e-75	229	370	21	162	ChainA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLH_AAAA Chain AAAA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLJ_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLK_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7SCI_A	5.09e-67	380	866	14	487	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
5KD2_A	7.72e-63	379	965	33	605	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD5_A	9.69e-60	412	965	20	557	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
5EV7_A	5.40e-24	451	878	45	418	Thecrystal structure of a functionally unknown conserved protein mutant from Bacillus anthracis str. Ames [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_03608.