CAZyme Information: MGYG000004797_03889

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_03889
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000004797_92|CGC1	59674.18	6.1942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 6004; End: 7575 Strand: -

Full Sequence      

MKSILLSLFLACICKMLSGQSQTTVHFEIETDHPCQIMEYFGASDCWSMQFIGLWPQEKQ
NQVADWLFSTESHENGQPKGIGLSLWRFNVGAGSAEQGEASQIASPWMRAECFLQADGNY
NWNKQQGQRNFLHLAKERGVNQFLAFLNSPPVYFTQNSLATNTGRGGTLNLKEEHYEDFA
RFLANVIKGVEKHDGIKFNYLCPFNEPDGHWNWTGPKQEGTPATNREIARAIRLISKEFV
NNQIDTQILVNESSDYRCMFDTHMTNWERGYQIQSFFNPDSTTTYLGDTPNVPRLMAGHS
YWTNTPLNNLHDIRCQLKDTLDKYKVDFWQTETCIMGNDEEIGGGGGYDFTMKTALYVAR
IIHHDIVYAGARSWQWWRSIGGDYKDGLIREYSDPTFLNGEVKDSKLMWALGNYSRFIRP
GAVRKAIIAKDNQGKIIPEGDTDVTGLMCSAYQNTDGKEVFVMINYAAEDKEFTFYQRNG
IIKNWKIYRTSDKDGENLLPVGSVKNHEKVVIPARSIITLVTQ

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	26	521	7.3e-197	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	7.59e-143	24	389	1	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	5.27e-11	149	474	124	404	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY38682.1	0.0	25	523	23	521
ABR38541.1	0.0	25	523	23	521
QEW34957.1	0.0	25	523	23	521
QJR57513.1	0.0	4	523	2	520
QJR62087.1	0.0	4	523	2	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	3.00e-92	27	523	8	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7NCX_AAA	5.20e-07	20	465	7	393	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7O0E_A	2.65e-06	23	465	3	386	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
1NOF_A	3.06e-06	149	491	84	349	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]
6M5Z_A	6.16e-06	60	465	59	397	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	7.49e-14	39	421	36	381	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	9.25e-07	20	465	24	410	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000910	0.991497	0.006983	0.000229	0.000192	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_03889.