CAZyme Information: MGYG000004797_04244

Basic Information

• Species: Phocaeicola sartorii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sartorii
• CAZyme ID: MGYG000004797_04244
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000004797_121|CGC1	43011.23	8.692

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004797	5247182	MAG	China	Asia

• Gene Location: Start: 7510; End: 8649 Strand: +

Full Sequence      

MRYYLIVGEASGDLHASNLMRALKREDPGAEFRFFGGDLMTAVGGTRVKHYKELAYMGFI
PVLLHLRTIFRNMKECKQDIVRWAPDVVILVDYPGFNLKIAEYVKKQTQIPVYYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVEFFAGHQYPVHYVGNPCVDAVDTYCKEHPDGFPE
FVVDNGLSGKPVVALLAGSRKQEIKDNLPIMLEAAAPFTKDYQLVLAGAPGMDPAYYSDY
MNPDVPVKIIFGQTYRLLRQARVALVTSGTATLETALFRVPQVVCYYTPVGKFIAFLRRH
ILKVKYISLVNLVAGKEVVRELVADTMTVDNVRSELEALLCNKVYGNRMLEEYDRIIRIL
GPAGASEAAAREMVALLKK

Enzyme Prediction     

No EC number prediction in MGYG000004797_04244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	2.7e-114	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.69e-105	1	379	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.65e-95	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.88e-73	4	323	2	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.60e-62	5	373	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.75e-49	9	331	10	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT59470.1	1.77e-261	1	379	1	379
QQY41518.1	1.77e-261	1	379	1	379
QQY38221.1	7.20e-261	1	379	1	379
ABR39591.1	7.20e-261	1	379	1	379
QEW38059.1	1.02e-260	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.00e-38	5	376	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.35e-37	5	376	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	5.38e-62	5	379	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.30e-59	2	379	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	2.49e-59	2	379	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	2.78e-58	2	379	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	3.80e-58	2	377	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004797_04244.