CAZyme Information: MGYG000004798_00024

Basic Information

• Species: Enterococcus_B hirae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B hirae
• CAZyme ID: MGYG000004798_00024
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205	MGYG000004798_1|CGC1	23302.32	5.6635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004798	2841576	Isolate	United States	North America

• Gene Location: Start: 22252; End: 22869 Strand: +

Full Sequence      

MAKKKWKKQKRNSLRLIAVIFGGILLMIAFVLSLRGLSAPLVGQEQNNNEAQTHQQFIDR
LAPHAKELQTGYGVLPSIILGQAILESNWGESTLASQYNNLFGIKAYGDQKKVNLETKEF
VNEEWVTIQGDFRVYDSWEQSMDSHTQLFVNGVDWNPALYEKVITATNYREAAQALQDAG
YATDPSYAQKIIQVIETYHLDQYDQ

Enzyme Prediction     

No EC number prediction in MGYG000004798_00024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	62	200	9.5e-40	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.43e-73	11	205	4	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	6.52e-40	50	204	316	472	amidase domain-containing protein.
smart00047	LYZ2	1.30e-37	49	204	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	1.14e-35	55	197	153	296	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	3.85e-35	57	195	151	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG05268.1	2.25e-145	1	205	1	205
QIV90156.1	2.25e-145	1	205	1	205
QXJ62039.1	2.25e-145	1	205	1	205
QQY22430.1	2.25e-145	1	205	1	205
AND72267.1	2.25e-145	1	205	1	205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	9.09e-26	40	204	8	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	5.53e-20	56	204	62	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.77e-18	57	196	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.81e-18	55	195	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.22e-18	55	195	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	9.20e-47	1	205	1	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	6.10e-26	38	204	51	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.11e-24	38	204	51	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	2.95e-24	38	204	51	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
Q2G222	3.69e-19	56	204	322	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000011	0.000000	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
12	34