CAZyme Information: MGYG000004798_01431

Basic Information

• Species: Enterococcus_B hirae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B hirae
• CAZyme ID: MGYG000004798_01431
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205	MGYG000004798_10|CGC1	22441.08	8.3431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004798	2841576	Isolate	United States	North America

• Gene Location: Start: 37798; End: 38415 Strand: +

Full Sequence      

MVLATTGLTTLSSVNVSAHGYVISPISRAYQGQLDKENIGYDFAVQKYGPIINEPQSLEA
PQGFPKGGPADGKIASANGARGFELDKQTSSLWTKQNLTGGATKFTWKYTQSHPTSKWHY
YITKPGWNQNKPLSRNELQLIGEVQGKGAQASTSPTHTITIPNDRIGYHVILAVWDVSDT
SNAFYNVIDANIQPRSILNDLNESM

Enzyme Prediction     

No EC number prediction in MGYG000004798_01431.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	19	191	4.1e-51	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3397	COG3397	3.05e-73	3	192	15	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
PRK13211	PRK13211	9.71e-70	2	192	7	193	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	2.48e-63	19	191	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	3.24e-62	19	189	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21174	LPMO_auxiliary	7.21e-05	61	189	18	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV81621.1	4.25e-150	1	205	11	215
QQY20896.1	4.25e-150	1	205	11	215
AFM70427.1	4.25e-150	1	205	11	215
QKX70208.1	4.25e-150	1	205	11	215
AND73200.1	4.25e-150	1	205	11	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YOX_A	2.40e-80	19	192	1	177	Bacillusamyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOX_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOY_A Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens],2YOY_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens]
2YOW_A	2.48e-80	19	192	1	177	Bacillusamyloliquefaciens CBM33 [Bacillus amyloliquefaciens],2YOW_B Bacillus amyloliquefaciens CBM33 [Bacillus amyloliquefaciens],5IJU_A Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens],5IJU_B Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens]
5LW4_A	1.79e-59	19	192	1	169	NMRsolution structure of the apo-form of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis],6TWE_A Cu(I) NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis DSM 13 = ATCC 14580]
2BEN_A	3.15e-52	19	192	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
2BEM_A	3.15e-52	19	192	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	1.03e-47	3	198	12	201	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q838S1	1.28e-43	18	193	28	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q8D7V4	8.49e-40	49	189	56	197	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1
Q9KLD5	1.65e-39	19	189	24	198	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1
A5F0H4	1.65e-39	19	189	24	198	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.892099	0.106749	0.000542	0.000232	0.000134	0.000256

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004798_01431.