CAZyme Information: MGYG000004798_01432

Basic Information

• Species: Enterococcus_B hirae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B hirae
• CAZyme ID: MGYG000004798_01432
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214	MGYG000004798_10|CGC1	23525.26	6.9235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004798	2841576	Isolate	United States	North America

• Gene Location: Start: 38759; End: 39403 Strand: +

Full Sequence      

MKKSLVVGLGLVLATTGLTALSTVNVDAHGYVEKPISRAYQGELDSRKNWHAALEKYGEI
ITEPQSLEAPKGFPNGGPADGKIASANGAKGFELDKQTATIWTKQNLSTGPTKFTWSYTA
AHKTAKWHYYITKNNWNPNKPLSRDEFQFIGEVDGHGKDADTNLTHTITIPSDHLGYHVI
LAVWDVNDTSNAFYNVIDANIQPRNLLTDLSNNS

Enzyme Prediction     

No EC number prediction in MGYG000004798_01432.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	29	200	3.2e-51	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3397	COG3397	5.51e-78	1	201	1	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
PRK13211	PRK13211	6.32e-71	1	201	1	193	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	4.11e-58	29	200	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	4.47e-57	29	198	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21174	LPMO_auxiliary	4.77e-06	70	198	18	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY20897.1	2.43e-158	1	214	1	214
QKX66868.1	2.43e-158	1	214	1	214
ASV81620.1	2.43e-158	1	214	1	214
AFM70426.1	2.43e-158	1	214	1	214
QXJ62529.1	6.97e-158	1	214	1	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YOX_A	5.04e-82	29	201	1	177	Bacillusamyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOX_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOY_A Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens],2YOY_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens]
2YOW_A	5.22e-82	29	201	1	177	Bacillusamyloliquefaciens CBM33 [Bacillus amyloliquefaciens],2YOW_B Bacillus amyloliquefaciens CBM33 [Bacillus amyloliquefaciens],5IJU_A Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens],5IJU_B Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens]
5LW4_A	1.23e-59	29	201	1	169	NMRsolution structure of the apo-form of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis],6TWE_A Cu(I) NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis DSM 13 = ATCC 14580]
2BEN_A	4.64e-54	29	201	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
2BEM_A	9.33e-54	29	201	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S1	7.99e-50	1	202	1	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q8EHY2	1.21e-43	13	200	9	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q87FT0	8.07e-42	28	198	23	198	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
Q9KLD5	2.96e-41	29	198	24	198	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1
A5F0H4	2.96e-41	29	198	24	198	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999084	0.000182	0.000172	0.000153	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004798_01432.