CAZyme Information: MGYG000004798_02426

Basic Information

• Species: Enterococcus_B hirae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B hirae
• CAZyme ID: MGYG000004798_02426
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1013		115555.88	9.579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004798	2841576	Isolate	United States	North America

• Gene Location: Start: 144924; End: 147965 Strand: -

Full Sequence      

MPDLNEPNNEQQESQNSIISTGLEKTKGLIKDQKKSSELTKAILKNNQTIKVTIIVHRND
KLPIIKKKSRLKRVIKQGKQKIKLTKKQISKIKRDVEEFGNKTVVLAKNRFRKVLGIKRK
NDQKKVRQELRADSKSQNNIQGTKQSTDQPKVNVQKKQLKKEQLKKVAEETKKGNLVARS
SKDSTPYSYTAYKDQKGFAPQDSVKSTKKKWYNIFGKGKNTEVVYVNPTKGVGKKGGFFK
NFLGKAKSAPKFLDMAQKLSPKGQAKEAAMKMLGGRDEKGDLTIIGILITLIFLVITIKA
LLIIAIVIVILAIILVVISVVLAIWTFIVALFTLKTEDMAIAEAFEYISYLDASKNRDVY
NRYNQLVEEHDEVYFEVNGMVADPEQFSFASNGDNYIYYLNAKYENYNIKNSALPNYLKR
LKDQTSMSPPLYMSFYAQFKDKYSPMEEEPVKIAKVEDELRAIHDGTFTYKVEFEEEKDK
EEKDKEDKEEKDKDSVTLNVKVQTIAEFLDLDPQIELYSNNKVIGTISAFSQDEIDKYYP
VLEIDRFQDKIFMDNPLGKVSYASVIGNYGYRGRDDANMNDEIIIDAKPQTPVYATSNEK
VTEISTRTARDLNGKKQTTTSIKTETGKYQAYYINVTPIIREGASLESGDLIGYTSDKFD
GNLLMIMKEKRIFLYRNPEINPTIFIENLVYGNRTKLSQYDREQSQGELIYPPEKVVQWR
EKVVTEAKKQNIESFTNVILSIIWVESGGDGETVPDIMGIAKAQNLNQTINPEKSIELGV
AYFANLIRKAQMYQLGNLAAIQAYNYGEDYLDELIRTDSKYTFEHSKAYAQERSNGEVVS
YNKGVALDLGYNWRYAFGDMFYARLISYNLSNSTGKLVEVATKEIGTLNGNKYWEWAGYE
SRMEWSAIFVTWVAEQAGYLSQGRVPNTVRPLDMFNWYKKNNKFKATDIGYIPQPGDLIF
FDWKGNKTGKDQVGIVEFTGGNTIQVIEGNSENMVRRRTYTLDHSAISGYGVP

Enzyme Prediction     

No EC number prediction in MGYG000004798_02426.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	3.72e-50	719	871	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	2.54e-28	713	870	1	165	Lysozyme-like.
pfam05257	CHAP	1.95e-07	909	990	13	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
cd00254	LT-like	4.90e-05	739	812	4	86	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.37e-04	727	808	5	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY21310.1	0.0	1	1013	1	1019
ASV82958.1	0.0	255	1013	1	759
QKX72497.1	0.0	255	1013	1	762
AFM69978.1	0.0	255	1013	1	765
QKX70108.1	0.0	255	1013	1	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	3.06e-21	692	961	1	261	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	6.15e-19	727	893	35	202	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34636	1.10e-06	714	884	50	217	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
280	302
307	329